6EM5


Conserved Protein Domain Family
Spb1_C

?
pfam07780: Spb1_C 
Spb1 C-terminal domain
This presumed domain is found at the C-terminus of a family of FtsJ-like methyltransferases. Members of this family are involved in 60S ribosomal biogenesis.
Statistics
?
PSSM-Id: 400230
View PSSM: pfam07780
Aligned: 106 rows
Threshold Bit Score: 155.471
Threshold Setting Gi: 567996064
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EM5_WW             621 FEivandn----aseefdSDYDSeeeknqtkkekhsrDIDIATVEAMTLAHQLALGQKNKHDLVDEGFN-RYTFR-DTE- 693
Q9VXK5              610 NEdsdgeqp----------------------aagtnaKKVRLSENEMALGALLTRSKKTRRDLIDAAWN-RYAFN-DE-- 663 fruit fly
XP_002011289        612 SEqevdednvagdmakapKA-----------------KKIRLSEEELALGALLVRGKKTRRELVDAAWN-RYAFN-DE-- 670 Drosophi...
WGS:AAPP:GF10393-PA 606 EEdatnpe-----------------------sgegkaKKVRLTESELALGSLLIRGKKTRRDLIDASWN-RYAFN-DE-- 658 Drosophi...
XP_002122891        521 SDydveetlneakpvtttKGKKQ--------------KTQKLDAEALALGTVIATSNKRKRDVIDDSFN-RYTFN-DEEc 584 vase tun...
XP_004067778        637 FQvvpve--------------------------stskKARILNAEGLALGCQIATSKKKTRDLVDNSFH-RYAHSeDTW- 688 Japanese...
XP_014324804        640 FQvvpve--------------------------stskKARILDAEGLSLGCEIATSKKKARDLVDFSFH-RFANSdEPW- 691 southern...
XP_003768541        637 FVvvpi---------------------------edpvKRQILDPEGLALGAMIASSRKARRDLVDDSFS-RYTYNeEEG- 687 Tasmania...
ERE69242            632 FEvvpi---------------------------edpvKHRILDPEGLALGAVIASSKKAKRDLIDNSFN-RYAFNeDEG- 682 Chinese ...
AAI59356             79 FEvvple--------------------------ctvkRSRVLGPDGLALGTVIATSKKSTRDLIDSSFNrR-NFNdDED- 130 tropical...
6EM5_WW             694 NLPDWFLEDEKEHSKIN---KPITKEAAMAIKEKIKAMNARPIKKVAEAKARKRMRAVARLEKIKKKAGLINDDSDKTEK 770
Q9VXK5              664 NVPVWFKLDEDEHMTKP---TPVPKELTAEYQRKLQEVNVRPIKKVMEAKARKHRRATKRLAKAKKMAEKIMENSDATNH 740 fruit fly
XP_002011289        671 NLPAWFVQDEAEHMTKP---HPVPKELTEEYQRKVQELNVRPIKKVMEAKARKKRRATKRLAKAKKMAEKIMENADATSQ 747 Drosophi...
WGS:AAPP:GF10393-PA 659 NLPTWFVQDESEHMTKP---NPVPKELADEYERKKLELNARPIKKVMEAKARKKRRATKRMAKAKKMAEKIMENADATSH 735 Drosophi...
XP_002122891        585 ALPDWFLEDEKKRVVKNhlrHHVSKDMMDFYGSKDKGINVRTIKKVVEAKARKKRKATKKMEKARKQAEGISDTADMSTK 664 vase tun...
XP_004067778        689 EVPEWFLDDERKHRQRP---VEVTKEMVEEYKQKWKEINARPIKRVAEAKARKKRRMLKKTEQAKKKAEAVVNTVDISER 765 Japanese...
XP_014324804        692 EVPEWFLDDERKHRTRP---MPVTKEMVEEYKQKWKEINARPIKRVAEAKARKKRRMLKKMEQAKKKAEAVVNTADISER 768 southern...
XP_003768541        688 DLPEWFVQEEKQHRIRP---LPLDKKTVEEYRKRWREINARPIKKVAEAKARKKRRMLKKMEQTKRKAEAVVNTVDISER 764 Tasmania...
ERE69242            683 ELPEWFVQEEKQHRIRQ---LPIDKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKKLEQTKKKAEAVVNTVDISER 759 Chinese ...
AAI59356            131 ELPDWFVSEERKHRIVQ---VPVDRYMMEEYRKQQRELNARPIKKVAEAKARKKRRTLKKMEQIKKKAEAVVNTSDISER 207 tropical...
6EM5_WW             771 DKAEEISRLMRkvTK--KPK-TKPKVTLVVASGR-NKGLAGRPKGVKGKYKMVDGVMKNEQRALRRIAK 835
Q9VXK5              741 EKSKQLKKVYK--KA---QE-KKKEVTYVVAKKQtAARRARRPAGVKGRYKVVDPREKKDKRSMDAKKR 803 fruit fly
XP_002011289        748 EKAKQLKKIYK--KA---QE-KKKEITYVVAKKHtASRRARRPPGVKGRYRVVDPREKKDKRSIVAKKR 810 Drosophila mojavensis
WGS:AAPP:GF10393-PA 736 EKAKQLKKVYK--KA---QE-KRKEITYVVAKKQtASRRARRPAGVKGRYRVVDPREKKDKRSLDAKNK 798 Drosophila ananassae
XP_002122891        665 EKAAHIKNIYK--KAglLKK-KKENTTYVFAKRG-TGKRVRRPPGVSGKFKVVDKRMKKDLRPQGKNSK 729 vase tunicate
XP_004067778        766 EKMAQLKSIYK--KA--GLGkEKREVTYVVTKKG-AGKKVRRPPGVKGVFKVVDGRMKKDMRGMQRKEQ 829 Japanese medaka
XP_014324804        769 EKMAQLKSIYK--KAgvKKE--KREVTYLVAKKG-VGKKVSRPRGVKGLFKVVDGRMKKDMRGVQRKEQ 832 southern platyfish
XP_003768541        765 EKMAQLRSLYK--KAgfGKE--KRQVTYVVAKKG-VGRKVRRPAGVKGHFKVVDTRMKKDLRAQQRKEQ 828 Tasmanian devil
ERE69242            760 EKVAQLRSLYK--KAglGKE--KRQVTYVVAKKG-VGRKVRRPAGVRGQFKVVDSRMKKDQRAQQRKEQ 823 Chinese hamster
AAI59356            208 EKAAQLRSIYR--KCglGKE--KPQVTYLVAKKG-VGRKVRRPAGIKGHFKVVDGRMRKDTRSQKRRK- 270 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap