Conserved Protein Domain Family
Cas1_AcylT

?
pfam07779: Cas1_AcylT 
10 TM Acyl Transferase domain found in Cas1p
Cas1p protein of Cryptococcus neoformans is required for the synthesis of O-acetylated glucuronoxylomannans, a consitutent of the capsule, and is critical for its virulence. The multi TM domain of the Cas1p was unified with the 10 TM Sugar Acyltransferase superfamily. This superfamily is comprised of members from the OatA, MdoC, OpgC, NolL and GumG families in addition to the Cas1p family. The Cas1p protein has a N terminal PC-Esterase domain with the opposing Acyl esterase activity.
Statistics
?
PSSM-Id: 400229
View PSSM: pfam07779
Aligned: 21 rows
Threshold Bit Score: 489.498
Threshold Setting Gi: 429863446
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KJE94275      466 DVTCCAPY-PALTGLQYVFFAV--------VLFALVCWLGGSYAARH---------HTGGAVASgaesafgatararhml 527  Capsaspora ow...
ELA37897      240 QVTCCAPY-PSLSRVQVLLLGLs-------ILALPILFLDRRQDAFP---------SARTSQVMd--------------- 287  Colletotrichu...
Q6CDI8        313 SDTCCIHYkQPRTMGQVLLLGVi-------CAILPIIYLGQRYTRSDyyprfvryvSWPVPSIQd--------------- 370  Yarrowia lipo...
2_pfamImport    3 DGTCCKKP-DPVTVVQIILATFgslwfvyhFCFVVVNLVQKHVQRPS---------PGTEEENKknni------------ 60  
XP_006636227  353 DGSCCHPR-PPLNIVQKLTAGVfa----saIMSFLVLNLLCYSKHRR---------SRHVTDLEnaeekrpa-----aat 413  spotted gar
XP_519208     435 DGSCCQPR-PPVTLIQKLAACFft----lsIIGYLIFYIIHRNAHRK---------NKPCTDLEsgeekkni-----int 495  chimpanzee
XP_012821059  228 DGSCCQPT-PSLTIIQKLAACFfi----faMIAFVSVTIVQRNKHRR---------NKQCDDIEsgeekkpa----tatp 289  tropical claw...
XP_006011687  301 DASCCLPK-PSFTVIQKLTACFfg----isIIGFLIFSYLFRNNHKK---------SKPCTDVEsgeekptt-----atp 361  coelacanth
EKC31313      303 DGTCCRVP-DSITSIQIITAAFflvcllsaIAMFLYRRRIRRNGSKA---------RAADNGIRngrsyvts----tekt 368  Pacific oyster
XP_031594672  299 DGSCCQTL-RAPNLLQKLSALFfl----gsAVVFVVFHILGNNRHRR---------HVP-PDVEsleekkpa-----taa 358  Oreochromis a...
KJE94275      528 sspnLLSVAMPVAQLGLVLVFAFLCDRTHIFPKERKIYTHFDLIAS-IGVMFVAGWCTLTHvKTAP-------------- 592  Capsaspora ow...
ELA37897      288 -------sLLAAATLVAIAVYCLLADRTHLLIKHDKHFDVPDFILPvIGLVILAGL------SLRSrppvlssakglatt 354  Colletotrichu...
Q6CDI8        371 -----eTLLTACVVIAASLAYSFFCDRTQFFGKSSKQFEASEFWVL-ILLFLVATGYSFEPqNDNS-------------- 430  Yarrowia lipo...
2_pfamImport   61 -rttIVELVSAAAKMSLILLYFYICDRTDVFMKANKHYTNTRFFLP-LLYIVFLGVFGIDA-AEKP-------------- 123 
XP_006636227  414 smasLKVPFQSVCKLGLIMVYFYLCDRADIFMKEQKFYTHSTFFIP-LIYIFVLGVFYTEN-GKET-------------- 477  spotted gar
XP_519208     496 pvssLEILLQSFCKLGLIMAYFYMCDRANLFMKENKFYTHSSFFIP-IIYILVLGVFYNEN-TKET-------------- 559  chimpanzee
XP_012821059  290 aassLEILLFSLSKLGLIMAYFYFCDRANLFMKENKFYTHSSFFIP-IIYILVLGVFYNEN-TKEA-------------- 353  tropical claw...
XP_006011687  362 apanTEILLQSLCKLGLIMAYFYLCDRANLFMKEHKFYTNSTFFVP-LIFILMLGVFCNEN-AKES-------------- 425  coelacanth
EKC31313      369 wpdtLYEIMLCLAKLGLIMAYTFLCDRTNFFMKENKYYTHVNFLLP-FAYLMILGFFFTEN-TDQT-------------- 432  Pacific oyster
XP_031594672  359 vppgPKAPFQALCRMGVIMGYFYLCDRADVFMKEQKFYTHSTFFIP-LIYIFVLGVFYSDN-SKEA-------------- 422  Oreochromis a...
KJE94275      593 TFLSRDQTDEWKGWMQIVFLIYHFLGGSSVLPLYMLVRVFVASYLFLTGFGHFTFFYTKKQFGITRIIQVLTRLNVLTIG 672  Capsaspora ow...
ELA37897      355 SFLSREQTDEWKGWMQAFILLYNYHAASESLAMYKVHKFLVATYIFLSCYGHTSYFLRTEDFSLRRATYVLVRLNLLSCI 434  Colletotrichu...
Q6CDI8        431 -FLNRHQTEEWKGWMQIIILIYHITGASKILPIYKFVRVLVAAYLFMTGFGHATFFIKRGDFSLKRATSVLFRMNFLSIL 509  Yarrowia lipo...
2_pfamImport  124 VFLNRNQTDEWKGWMQLIILIYHMTGASVNVPIYMHIRLLVSMYLFMTGYGHFSYFWNKGDFGLHRVFGVMFRLNFLTIM 203 
XP_006636227  478 KVLNREQTDEWKGWMQLVILIYHISGASAFIPVYMHVRVLVAAYLFQTGYGHFSFFWLKGDFGLNRVCQVLFRLNFLVVV 557  spotted gar
XP_519208     560 KVLNREQTDEWKGWMQLVILIYHISGASTFLPVYMHIRVLVAAYLFQTGYGHFSYFWIKGDFGIHRVCQVLFRLNFLVVV 639  chimpanzee
XP_012821059  354 KLLNREQTDEWKGWMQLVILIYHISGASSFLPVYMHVRVLVAAYLFQTGYGHFSYFWLKGDFGIYRISQVLFRLNFLVVV 433  tropical claw...
XP_006011687  426 KLLNRDQTDEWKGWMQLVILLYHISGASSFLPVYMHVRVLVAAYLFQTGYGHFSYFWIKDDLGLYRLCQILFRLNFLVVV 505  coelacanth
EKC31313      433 KVLHRDQTDEWKGWMQLVIMIYHLTGASKVLPIYMHIRVLVSAYLFLTGYGHFSYFWNKSDFSVQRYCQVMFRLNFLVVV 512  Pacific oyster
XP_031594672  423 KLLNREQTDEWKGWMQLVILIYHISGASAFIPVYMHVRVLVAAYLFQTGYGHFSFFWLKGDFGLYRVCQVLFRLNFLVLV 502  Oreochromis a...
KJE94275      673 LCMVMDKPYQFYYFVPLSSFWFLVVYAIMAFPsiPAVQKRF------PGLDAPARILALFTICSIVWLPFSgnykstsad 746  Capsaspora ow...
ELA37897      435 LGLATSSEWIIYS-APLMTFWFGVTFASLACFktLNNNPVA----------FFLKIVVFATCTTFLVRSTH--------- 494  Colletotrichu...
Q6CDI8        510 LAYVMDTDYLFYYFAPLVSFWFCVVWITFRVL--PSWNSIDtsv-----gpVLAKISASAVILNILVRFQL--------- 573  Yarrowia lipo...
2_pfamImport  204 LCLTMDRPYQFYYFVPMCSFWYLVLYLTMAMW--PRAYISSptnentAVFKMILKLSFLFFLIVVVFISQN--------- 272 
XP_006636227  558 LCLVMDRPYQFYYFVPLVTFWFAVIYVTLAIW--PQILQKKangsgiWHLGLLLKLLALLLFICFLTYSRG--------- 626  spotted gar
XP_519208     640 LCIVMDRPYQFYYFVPLVTVWFMVIYVTLALW--PQIIQKKangncfWHFGLLLKLGFLLLFICFLAYSQG--------- 708  chimpanzee
XP_012821059  434 LCVVMDRPYQFYYFVPLVTFWFMFIYATMAVW--PQILQKTananslWNCGLIIKLTFALLCIIFLSYSQG--------- 502  tropical claw...
XP_006011687  506 LCLVMDRPYQFYYFVPLVTFWFVVIYVVFALW--PPIVNRTasgscfWNLSLLLRLGLLLTCICILAYFQS--------- 574  coelacanth
EKC31313      513 LCFVMNRPYQFYYFVPLVSFWFTVVYLTMAIW--PRISDASceasnlHYLYMIIKFIILTTVITLFFMSEV--------- 581  Pacific oyster
XP_031594672  503 LCVVMDRPYQFYYFVPLVTFWFVVIYTTMAIW--PQILQKTanssgvWHFGVLAKLLGLLIFICFFAFSQG--------- 571  Oreochromis a...
KJE94275      747 dfpIFQFLFDWWPIKELF-SVSDSLYEWRFRSGLDCFIVAHGMLIAYAYQIAKSHGVIHDNQpavrpgttppppgpllSG 825  Capsaspora ow...
ELA37897      495 ---LPETFLRI--LKSTS-GIHWNVDMLRSHFALNRFVPYFGILTAAA---AHRVSVLRRRQhginarapferandafDR 565  Colletotrichu...
Q6CDI8        574 ---PFQIVFAV--LKYLF-NIQWNLREWRFRLILDIYIVYIGMFAAVATLRYKQGNFPLK-------------------- 627  Yarrowia lipo...
2_pfamImport  273 ---LFESMFSWWPVIRLFeLPSGMVREWWFRCHLDRFAVLHGSLFAFSYIMLKRLSVVDDSR----------------QG 333 
XP_006636227  627 ---VFNSIFSIWPISKLF-ELHGSSHEWWFRWKLDRFAVFHGMLFAFVYLVLQKCQVLSEGK----------------GE 686  spotted gar
XP_519208     709 ---AFEKIFSLWPLSKCF-ELKGNVYEWWFRWRLDRYVVFHGMLFAFIYLALQKRQILSEGK----------------GE 768  chimpanzee
XP_012821059  503 ---AFENVFSLWPLSKLF-ELNGNVYEWWFRWKLDRFAVIYGMAFAFIYLWLQKHQVLFEGK----------------GE 562  tropical claw...
XP_006011687  575 ---TFEAVFATWPVSKLF-ELQGSVHEWWFRWKLDRFAVFHGMMFAFLYLTLQKWQVFSEGN----------------GE 634  coelacanth
EKC31313      582 ---LFEKVFLMRPIKALFvRSDDSLHEWRFRWTLDRYSVVYGMVFAFGYHLLLKKGIIADNH----------------TK 642  Pacific oyster
XP_031594672  572 ---IFERVFSVWPISKLF-ELNGSIHEWWFRWKLDRFAVIHGMLFAFIYLVLQKRQVLSEGK----------------GE 631  Oreochromis a...
KJE94275      826 LLF-------NT-ATSAILSIVS---IGIFCWYIMFTRSCTDKAYCNYIHTFSSPFLVAAFAFLRNLTGRSRAVYSRFFA 894  Capsaspora ow...
ELA37897      566 GILeiayperDAiPVKPIMICFAiayLVVFIILAFAADVYHNNDSYNAFHPYISPWFVLSAVITRNSFKALRELHVPLCA 645  Colletotrichu...
Q6CDI8        628 ----------NLvTNRLVLGVVA---LITFIVYIAVAASFGIKQNYNQAHPYISWMPIVAFVILRNITVRFRSHYSTWMS 694  Yarrowia lipo...
2_pfamImport  334 CLF-------ST-KVSLIAVTTS---IICTLLYSIWAMHCTDKQSCNEVHSFASLIPISAFILIRNIPGYLRAGYSAFFA 402 
XP_006636227  687 PLF-------SN-RVSNCLLFIS---VVSFLTYSIWASSCKDKTECNELHPYISVVQILAFVLIRNIPGYARSLYSSFFA 755  spotted gar
XP_519208     769 PLF-------SN-KISNFLLFIS---VVSFLTYSIWASSCKNKAECNELHPSVSVVQILAFILIRNIPGYARSVYSSFFA 837  chimpanzee
XP_012821059  563 ALF-------ST-KVSSVLLFFS---VVSFFTYSIWASSCKNKSECNEMHPSISVVQILSFVLIRNIPGYARSVYSSFFA 631  tropical claw...
XP_006011687  635 PLF-------SH-MVSYCLLFVS---VVSFLSYSIWAANCKIKAECNEWHPYISVIQILAFVLIRNIPGYARSVYSTFFA 703  coelacanth
EKC31313      643 SLF-------ST-GVSLSLTILS---FIGLGSYAIFSFLCKNKTECNDTHSYLVALPLISYVTVRNVLGWVRTRYSSFFA 711  Pacific oyster
XP_031594672  632 ALF-------SA-KISNFLLFLS---VVSFITYSIWASSCKTKTECNEMHPYISVVQILAFILIRNIPGYARSIYSSFFA 700  Oreochromis a...
KJE94275      895 YIGQLSLELFLLQFHIWLAADTKGILVLI-PGtsgfW-----RLLNAAFTTGLFVAVSEVASDSSALIVSLLAPGDNTRA 968  Capsaspora ow...
ELA37897      646 TLGRLSLEAYVLHHHIWLASDGAGVLRIGrPG----Yl---pRSLEVVIIAAIFLWACAKSHSATRRIACSLTGTENQEE 718  Colletotrichu...
Q6CDI8        695 FIGTCSLETFTLQFHFFLAADTKGRLYILnTPtssgVlgmlqKYLNFGLVTVIFIIVSHAVAEQSNALTKLFVGNQDQQL 774  Yarrowia lipo...
2_pfamImport  403 WFGKISLELFIGQYHIWLAADTKGILVLTsPD----W-----PMLNLLITTFIFVCVAHEIFSLTGVFAKHLVGSPKSAD 473 
XP_006636227  756 WFGKISLELFICQYHIWLAADTKGILVLV-PG----Y-----PMLNIVISTFIFVCVAHEISQITNDLAQVAIPKDSSAL 825  spotted gar
XP_519208     838 WFGKISLELFICQYHIWLAADTRGILVLI-PG----N-----PMLNIIVSTFIFVCVAHEISQITNDLAQIIIPKDNSSL 907  chimpanzee
XP_012821059  632 WFGKISLELFICQYHIWLAADTKGILVLI-PG----N-----PMLNIIISTFIFVCVAHEISLITNDLAQIVVPKESSAL 701  tropical claw...
XP_006011687  704 WFGKISLELFICQYHIWLAADTRGILVLI-PG----N-----PVLNIIISTFIFVCIAHEISKITNDLVQIAIPKDDTAL 773  coelacanth
EKC31313      712 WFGKISLELFIAQYHIWLAADTYGVLVLM-PT----Y-----PVLNVILTSFIFICASHEISKITGILTNYLVPKEGKAL 781  Pacific oyster
XP_031594672  701 WFGKISLELFICQYHIWLAADTKGILVLI-PG----N-----PSLNILVSTFIFVCVAHEISLITNDLAQVVIPKDSMAL 770  Oreochromis a...
KJE94275      969 VISR 972  Capsaspora owczarzaki ATCC 30864
ELA37897      719 SEDV 722  Colletotrichum fructicola Nara gc5
Q6CDI8        775 PEHV 778  Yarrowia lipolytica
2_pfamImport  474 SKTL 477 
XP_006636227  826 VKRL 829  spotted gar
XP_519208     908 LKRL 911  chimpanzee
XP_012821059  702 TKRL 705  tropical clawed frog
XP_006011687  774 LKRL 777  coelacanth
EKC31313      782 LRNA 785  Pacific oyster
XP_031594672  771 LKRL 774  Oreochromis aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap