Conserved Protein Domain Family
CENP-I

?
pfam07778: CENP-I 
Mis6
Mis6 is an essential centromere connector protein acting during G1-S phase of the cell cycle. Mis6 is thought to be required for recruiting CENP-A, the centromere- specific histone H3 variant, an important event for centromere function and chromosome segregation during mitosis.
Statistics
?
PSSM-Id: 369513
View PSSM: pfam07778
Aligned: 5 rows
Threshold Bit Score: 898.861
Threshold Setting Gi: 1020980048
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007669732  13 KRKRVSRGRRSTQTDLAAWRLGERTSGSKPVnlkTGQKQREEDFTSDDDQAqdgeRDSLRKALRYFEKGQISVPLRKNPT 92  platypus
XP_006257277  12 QQNRISQGSNSRQTTLLDWKVKDKAGNSKSV---LEESSSLEDSNHADDQT----EDALQTAVEYFQKGPKKASLSKDSV 84  Norway rat
XP_010599689  11 AQRRTSQGRLSDQ-------IKEKPSYSESIl-kHGQNNPEEDSEHA---------EVLQIALRYFEKGPIKTLQSKGKT 73  African savanna...
XP_016153800   9 TPKQ--HVRSKSQTDLSAWRKGGRIDSEKSL----------QN-QSANDQKydsqEGSLKQALSYLEKVQGRVALKKNSV 75  Collared flycat...
Q8AYS7         9 HSKRPLQVHHSNQTDLSAWRKGGTVDTEKSA----------QNRQSLSDQKndneQDSLEQALSYFEKIQDRVSLKKSEV 78  chicken
XP_007669732  93 LQKHLETVENVAWRTGLPPESIDTLLNVALSGRFAEAVNTRLLKCMIPTTLILETSIVAAVSWLCVGKCSGSNKILFFRW 172 platypus
XP_006257277  85 LEKHLKTVENVAWNNGLAPEAIDILLNVALSGKFGNALSTRILKCMIPETHISEDSVVKAVSWLCVGKCSGNTKVLFYRW 164 Norway rat
XP_010599689  74 MEEHLKTVENVAWKNGLAPEKIDILLNVALSGKFGNSINTRILKCLIPATVISGDSVVKAVSWLCVGKCSGSTKVLFFRW 153 African savanna...
XP_016153800  76 LQKHLNAVESTALTQGLPPEGFEILLNVVLSGKFADTVNTCLLKCLIPASVIPENSVVKAVSWLCVRKCSANIQLLFLKW 155 Collared flycat...
Q8AYS7        79 LQKHLSTMESIALKRGLPPEGFDVLLDVALSGKLADTVNTRLLKSLIPASAIPESSIVSSVSWFCVSKCSSNIQLLFLRW 158 chicken
XP_007669732 173 LIAMFDFVDHKEQINSLYGFIFAFLQDENLCPYICHLLYLLTRRENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFCP 252 platypus
XP_006257277 165 LVAMFDFIDHKKQINSLYGFFFVSLQDDTLCPYVCHLLYLLTKKENVKPFRARKLLDLQAKMGMQPHLQALLSLYKFFAP 244 Norway rat
XP_010599689 154 LVAMFDFVNEKDQVNSLYGFFFASLQDDALCPYVCHLLYLLTKKENVKPFRVRKLLDLQTKMGMQSHLQALLSLYKFFAP 233 African savanna...
XP_016153800 156 LITMFDFIDHKEQLRALYGFFFFFLQDDKMCPFVCHVLYLLTRKENVKAFRIRALLDLQAKMGMQSHLQALLSLYKLYCP 235 Collared flycat...
Q8AYS7       159 LITMFDFIDHKEQVHALYGIFFSFLNDEKLCPYICHVLYLLTRKENVKPFRVRRLLDLQSKMGMQPHLQALLSLYKLFCP 238 chicken
XP_007669732 253 ELVSISLSTNRKTYFKDSECLWKTALSAVRQRNQGPSPGSPKLILGTTSIQSRRRKWNTSLVVPLCSSQDsnPQSGNReL 332 platypus
XP_006257277 245 TLISVSLPVRKKIFFNNSKNLWTPALLAVKLRNQGIFPEPLKLQLGPTSGRSLKRKWNYHSVIPAVNSAK--KECREK-M 321 Norway rat
XP_010599689 234 TLISVSLPVRKKIYFKNSENLWQMALIAVRQRNMGPSPVSLKLILGSAKVRPVNRKRNSYSVIPLPNSSNyvRECGKKeM 313 African savanna...
XP_016153800 236 EQVTITLPGKMKTYFKNPEGPWKAAIAAVRQRNQGTSALSQRMFLGTSQPQSRKRKWNAQLVIPASSTNNlgE---DRqK 312 Collared flycat...
Q8AYS7       239 ELVSITLPQKMKTYFKNADGPWKAAINAVRQRNQANSTVPQPLLLGTAQPHSRKRKWNTQLIVPASSANAqnLVVGGK-M 317 chicken
XP_007669732 333 KLVHFLKTDESFPPEQLHTFSQLLQNAHCLELPSQMGSVLKNSLLLHYLNCIKDESVLLRLHYWINNTLKEDCIWHPTGD 412 platypus
XP_006257277 322 SLFDYLSNDRSLPVEQLQSFPQLLENIHCLELPSQMSSVLNSSLLLHYVNCVKDESILLRLSYWLSQTLQEECVWYNMND 401 Norway rat
XP_010599689 314 SISDCLSNNGSFPVEQLQSFHQLLENIHCLELPCQMGSVLNSSLLLHYINCVRNESVLLRFYHWLSLTLQEECVWYKVNN 393 African savanna...
XP_016153800 313 NSVCLYSTNETFPVEQLQTFPQLLQNIHRLEFPSRMGSVLTNPLLLHYMNCVKDESIYLRLYYWMGQMLQEECTWCVVDN 392 Collared flycat...
Q8AYS7       318 SRADSYSANESFPVEQLRTFPQLLQNIHRLEFPSQMGSVLTNPLLLHYMNCSKDESVYLRLYYWMGQTLQEECTWCVVDN 397 chicken
XP_007669732 413 HLDNEEFKEFLNLIFRTECFLQEGFSSCEKFLYKSLPSWDGFGFRSQILPLVTWIPLRNFSEIKALLCEPLAQLFFTSSI 492 platypus
XP_006257277 402 YQQEKEFINFLDMVIRVQCFLQEGFYSCEAFLYKSLPLWDGFSCRSQFLKLLAWIPFSSFSEIKPLLLDHLAPLFFTSSI 481 Norway rat
XP_010599689 394 SEFGKEFTSLLDSIIRAQCFLQEGFYACEAFLYKSLPFWDGLCCRSQFLQLVSWIPFSNFCELKPLLFDHLAHLFFTSTI 473 African savanna...
XP_016153800 393 SS-EEEFKSFLETIYKSECFLQEGFSACEEFLYKTLPLWDGLCCRSEVLSLLSWISLSSFSDIKSYIYDPLAQLFFTSSI 471 Collared flycat...
Q8AYS7       398 NQYEEEFRGFLETVYKAECFLQEGFPSCEEFLYRSLPLWDGVSCRSQILQLVSWIPLSTFSEMKSQLCDPLAQLFFTSSL 477 chicken
XP_007669732 493 YFKCSILQTLRELLQNWLLSHATDMDEEPIINSP 526 platypus
XP_006257277 482 YFKCSLLQCLKDLLQNWLLWLSTEAQVQPMTDSP 515 Norway rat
XP_010599689 474 YFKCSVLQSLKELLQNWLLCLSTDIHMKPVLNSP 507 African savanna elephant
XP_016153800 472 YFKCSVIESLKELLQNWLNESQMHLEL-----SS 500 Collared flycatcher
Q8AYS7       478 YFKCSVLESLKELLQNWLNWHVVQLDSES--DSQ 509 chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap