Conserved Protein Domain Family
S-layer

?
pfam07752: S-layer 
S-layer protein
Archaeal S-layer proteins consist of two copies of this domain.
Statistics
?
PSSM-Id: 400212
View PSSM: pfam07752
Aligned: 52 rows
Threshold Bit Score: 180.858
Threshold Setting Gi: 74533551
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TJY7           40 DTNETSPDEFC----WDST-----TFGGLYYSA-NkhkDLVASEDWWgerLQytetdgqyelGKnnpRNHVIGE--DELV 107  Methanosarc...
jgi:Mzhil_0197   94 aaqvENNVTNMtl-vADAQ-----NFAGFWYDI-D---DGLSSETLT---LYvnk----------tsGDRTLDDddSDVL 150  Methanosals...
jgi:Metev_1752  431 VANESEFNDLGti-tWTPKgetgySFAGFWYDL-A---DNRDSEKLM---VDvgh---------lsdTDRQLSDdpSDVR 493  Methanohalo...
WP_013897512     38 AWNLTGADANEif-vANAT-----NFAGFWYDI-D---DDESSEELW---IYkn-----------rtTARTLGDdpSAVE 93   Methanosals...
WP_015054980    567 LDEITGPLDFDri-eINAS-----NFAGFYYDV-D---TGISTESIW---IY----------SEtttSVNIIAP--EGLT 621  Methanolobu...
Q12X07           22 RGTILDSGNVSsi-aWDGS-----NWNALYFALnD---VGSNTESLC---YEnidpe-npaiGVt-pDNNIIDK--KELI 85   Methanococc...
jgi:Mmah_1944    35 GGNILDSGNVSsi-aWDGT-----NWSALYFGLnE---AGSNTEILY---YQdsdgt-npgiGAa-pTNNVIDK--KELL 98   Methanohalo...
Q8TSB4           42 RGPIINSSNNCgylcWSSS-----NWGPLYCEInN---EASYTESLY---YEniedgsnpplGG---TNCIIDE--GELV 105  Methanosarc...
Q8TSB4          341 RGNTYNTSSGTsl-lWNNS-----LWSAFYFDIkDpetSLKYSENLY---YQniegsehpaiNNtspGSNVIDE--GELV 409  Methanosarc...
WP_144020352    771 rgTLAEDENMT----WTPS-----NFEGFKYNIyS---DNIDSERLL---ILadl----------tkEQTIVPA--GSLL 823  Methanolobu...
Q8TJY7          108 YSTRQ---FPNKYKVvselgldaNTTPSelggmvYYKLPWFGKPYVAV-ENDA-------------TQLANLVIDQpgSD 170  Methanosarc...
jgi:Mzhil_0197  151 VYESNvqgVNATFEFn-------GNVYQ------YPKIGFLAEEYVPVeSDGPlveydgqgvfgdvDKLSRLLMDT--DD 215  Methanosals...
jgi:Metev_1752  494 YKSTIvsgIESEFDFnn----neSNPWT------YQKIGFLAEEYVPIvEDEA-------------DKLSKLVMDD--DT 548  Methanohalo...
WP_013897512     94 YISTVvpgIKPEFDFrdp--dnaSELFT------YEKIGFLAEEYVPIaQGQT-------------DKLSKLLMDS--DT 150  Methanosals...
WP_015054980    622 YTTRI---SPVDYKSr-------NLYGQ------YNIIGFLGEKCVPLgEKTP-------------DKFSRLLLDS--DE 670  Methanolobu...
Q12X07           86 YRTHT---YHKKYKLsak--tdaNAVST------YSVIPLFSKKYIAV-NNDA-------------SKMTTLIKEQggGA 140  Methanococc...
jgi:Mmah_1944    99 YSSHT---YSKKFKLsak--tdaTEVST------YSVIPWFGNKYVAV-DDKA-------------SKMASLVTEQggGS 153  Methanohalo...
Q8TSB4          106 YSTAP---YSKAYKAssk--ggsTEVDS------YCLMPWMCKKYVAV-DGDA-------------RKITPIVIEQgsSA 160  Methanosarc...
Q8TSB4          410 YSTTS---YDKTYRVkldhyfevQMVDN------YPVVYWLGNLYVAI-GGDA-------------RKITPVVFEQyyEQ 466  Methanosarc...
WP_144020352    824 YETK----MQTSYC---------GDAIQ------FQKLGLFGEEYIPLtDTSP-------------DKLAPLLIND--GN 869  Methanolobu...
Q8TJY7          171 KKILKAGDVWDLGKNYSLTVNQVDVEGNKVWFSLSKEGEELESGIVDAdgt--------ieNQLFTAK-ADFGDGNDQLY 241  Methanosarc...
jgi:Mzhil_0197  216 SWTLRVGETLDLEDGYAIEPQQIDVEGDKVWLELTKDGEYVDDEIIDVsd---------snDTTWFYD-QTVLDEDDVVT 285  Methanosals...
jgi:Metev_1752  549 SHTIRTGESLELADGYAITPQQIDVEGDKVWLELTKDGEFVDDKVITVte----------gTNTWTYD-QDVMGEDDIVT 617  Methanohalo...
WP_013897512    151 RYTLRTGQTLELADGYAITPLQIDVDGNKVWLELTKDGEFLDDKIIDVrsatgaqasqakqDRTWYYE-QDIMDEDDILT 229  Methanosals...
WP_015054980    671 KLVLRLGQPLELPEGYALEAKQIDVEGDKVWMEFSKDGEFIEDEILDLsn----------gTIVWTYEaDDVADEDDVPV 740  Methanolobu...
Q12X07          141 EKTLKEGESWDLGNDYSLKLNQLDADAGKAFVILYKDGIELDSDVLDMdgt--------ddDRAFIVK-DDLAGIDDLVY 211  Methanococc...
jgi:Mmah_1944   154 EKKLKEGEVWDLGKGYSLELFQLDVEGDKAFVLLYKDGKELDSTVIKLdgt--------ddDRSFVVK-DDFADLEDAVY 224  Methanohalo...
Q8TSB4          161 ETILKVGESWDLGKNYSLMCNQVDTDGGKVWLSLYKNGVELESDILDSes---------adSRTFVAK-DSFADMDDAVY 230  Methanosarc...
Q8TSB4          467 EKVLKVGESWDLGKNYSLICNQFDEDGGKIWLSLYKGEVELGSEVLNVstn-------dvdDRIFVET-ADFADKKDVIY 538  Methanosarc...
WP_144020352    870 TYIMESNQSLILANGYFLLPYKIDIEGSKVWLKLYQDGEFIDDEIIDT-------------SGTWTYLlDGILGEDDVEV 936  Methanolobu...
Q8TJY7          242 FITYVDSVFMSATDSFAVFKYTWLIDkNDILIIKEGDEYQGFEVKEASESELVLKNSDSITLNLDKDVknYFTDSWYFQT 321  Methanosarc...
jgi:Mzhil_0197  286 LAISVDQVFQGTVDSLVVIEGVWQIA-DDGLEIETDDTFGNMAIESTSDAQIIMELDSSITLRHDTTR--NVMEDLKFRM 362  Methanosals...
jgi:Metev_1752  618 LKVNIDEVFQGQVDSLAVIEGVWQIA-DDGIELESEDSYGNMEIDTVDGNTIDMILSSSITLSDDSEQ--HLMEDIYFKV 694  Methanohalo...
WP_013897512    230 LMVHVEQVFQGTVDSLVVIEGIWQIE-DDGLELETGDRFGRMEIDDVGDNVIRMALDTTITLRRDSTQ--HLMQDLYFRV 306  Methanosals...
WP_015054980    741 MKVAVTGLLQDQAVGWVMIDGLWLTDvGNIIQVHSQSQFGKMEVVCIGYNELYLANPRSITLKRGSSI--EIMDNFSIRI 818  Methanolobu...
Q12X07          212 FVTYLENTFKSTSESFAILKYTWLIDkDNVITIKKGDKFGLLKCKDVSENWINMSNDVVITLEMDNTV--YFTDDWYFQT 289  Methanococc...
jgi:Mmah_1944   225 FVTYIDETFRCSSECFAIFKYTWLIDkDNVSTIEEGDKVGLLKCREISENWINMSNHEEITLEMNEKA--YFTDDWYIRT 302  Methanohalo...
Q8TSB4          231 FVTYADTVFSSATDNFVRLKYTWLIDkDDVTIIKVDDKFGEMECTEASENLIKLSNANRMELKIDGDT--FFTDDMYIKT 308  Methanosarc...
Q8TSB4          539 FVTYVDKAFKSESDTFVKLMATLLLDkDTVLTIETEDKFGEMKCIEASENSIKLANEDSITLELDGDT--YFTDDMYFTT 616  Methanosarc...
WP_144020352    937 LKIHVGSI--SSVTDSISIKGVWMIDwENTFEIMPDDEFGILKVEPISNNMLLFTSIQDIDL-RDNTGskQIAGDLYFQV 1013 Methanolobu...
Q8TJY7          322 SD 323  Methanosarcina acetivorans
jgi:Mzhil_0197  363 AD 364  Methanosalsum zhilinae DSM 4017
jgi:Metev_1752  695 AD 696  Methanohalobium evestigatum Z-7303
WP_013897512    307 AD 308  Methanosalsum zhilinae
WP_015054980    819 Aa 820  Methanolobus psychrophilus
Q12X07          290 Sk 291  Methanococcoides burtonii DSM 6242
jgi:Mmah_1944   303 Sk 304  Methanohalophilus mahii DSM 5219
Q8TSB4          309 Sa 310  Methanosarcina acetivorans
Q8TSB4          617 Sk 618  Methanosarcina acetivorans
WP_144020352   1014 TN 1015 Methanolobus psychrophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap