5A1U


Conserved Protein Domain Family
Coatamer_beta_C

?
pfam07718: Coatamer_beta_C 
Coatomer beta C-terminal region
This family is found at the C-terminus of the coatamer beta subunit proteins (Beta-coat proteins). This C-terminal domain probably adapts the function of the N-terminal pfam01602 domain.
Statistics
?
PSSM-Id: 400183
View PSSM: pfam07718
Aligned: 77 rows
Threshold Bit Score: 150.368
Threshold Setting Gi: 154416164
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5A1U_G        682 PDDPISFMQLTAKNemnck-------edqfqLSLLAA-----MGNtqrKEA-ADPLA--------------SKLNKVTQL 734 
Q9UUF7        671 ADELLNIRQFQRVIeekqd--------lnfeSDIIQA-----TND---GMV-VEDLA--------------SKLDHIVQL 719  Schizosacchar...
EPY49426      670 PDDTLNIRQLSRAIeekae--------tsfeSDVIQA-----ASD---GIV-MEDLS--------------SKLDHVVSL 718  Schizosacchar...
CAM67517      702 IDTPVVFSQLSEGKdavfe--------leatAEGPGAaakgeGSE---RK--AQLFL--------------KKLEDTMPL 754  Leishmania in...
Q4GYW5        692 VDTPVMFTQIMEGKgslle--------leavDDLGSVva--nASI---EK--TEEFL--------------IKLEKTVPL 742  Trypanosoma b...
Q4DQP3        689 IDTPIIFTQLAQGKdafle--------leatDDLGSAia--nASI---DK--TEEFL--------------KRLEKTIPL 739  Trypanosoma c...
XP_002140133  707 pftTLNFRQLKEKVmlsgyd------llqveDDIDQY---------------EDPFKictknpnntdiidcNSLKRIYPI 765  Cryptosporidi...
Q1EQ38        634 IDEKIHYEIFNTADeeeneekesrieqikgeRKL-------------------------------------ERLNNIVQL 676  Entamoeba his...
XP_001581105  630 pDQRLSFSSLLGRKf---------------dQAGPAAanaknASL---KIQeETQEE--------------KSKKSLVVL 677  Trichomonas v...
A0BYB4        637 PDDPIIIRQLKGVSe---------------fNEIDLAddetsVAT---KQE-ENTYV--------------SRLGHIVQL 683  Paramecium te...
5A1U_G        735 TGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLT-LAPHDFANIKANVKVASTENGI 813 
Q9UUF7        720 AGFTDPVYCEAYVKIQQFDIILDILLVNRTDTTLQNLSVDLATLGDLKVVERPPPMN-LGPHAFKSVQATVKVSSTESAV 798  Schizosacchar...
EPY49426      719 TGYTDPVYVEAYVKIQQFDIILDILIVNRTDSTLQNLCLELATLGDLKIVERPAPLN-LAPRAFNSVQATVKVSSTDSGV 797  Schizosacchar...
CAM67517      755 SGFNDPVYCEASITVHQFDVSVDWLLVNCTSKQLTNLTIELVSLGGMKLCERPQTYT-LNPHETIAVRTSLKVSATESGV 833  Leishmania in...
Q4GYW5        743 SGFCDPLYCEASVTVHQFDITVDWYIANCTANVLRDVSIELTPLGSMKLCERPQVHT-IQPHGSVRIRTALKVGSPETGV 821  Trypanosoma b...
Q4DQP3        740 SGFCDPVYCEASVTVHQFDVSVDWYLVNKTSNLMQELTIELASLGGMKLCERPQVHS-LPPHGSLKLRTALKVSSTETGV 818  Trypanosoma c...
XP_002140133  766 TGLDDPVYIEVIVQVQQHDVLLELIIMNRANTALQNIQIEIYPYGNLQIVEKPQNINhLDPSEVVHLYSTVQVQSIETGI 845  Cryptosporidi...
Q1EQ38        677 TGYSDPFYIEAIVTVTHFDITLDCLIMNQTPSTLQNITIELIPHGGMTVKTKPSPVT-LGPGDFVRVSLGVKVDATTVGV 755  Entamoeba his...
XP_001581105  678 SGTCDPIFSECTMKPGKFDILLEINLLNQTLSNLLNVKVELYCSGKLELVDKPSTIT-LPAQQSDQIICSIKATSAEAGR 756  Trichomonas v...
A0BYB4        684 TGYCDPIYAEAFVNVHKYDIQFEVLMVNRWSKMVQNVQVEFRTQGESKVIEKAQGVI-LQPNQSARVRTTIKFSSQDIGV 762  Paramecium te...
5A1U_G        814 IFGNIVYDV 822 
Q9UUF7        799 IFGNIVYGG 807  Schizosaccharomyces pombe 972h-
EPY49426      798 IFGAISFGg 806  Schizosaccharomyces cryophilus OY26
CAM67517      834 IYGTVLYDA 842  Leishmania infantum JPCM5
Q4GYW5        822 ICASVLYEG 830  Trypanosoma brucei
Q4DQP3        819 IYASVLYDA 827  Trypanosoma cruzi
XP_002140133  846 LFGFVTFQL 854  Cryptosporidium muris RN66
Q1EQ38        756 ISGYVNYDI 764  Entamoeba histolytica
XP_001581105  757 IYGNILYDI 765  Trichomonas vaginalis G3
A0BYB4        763 VYGAIHYEN 771  Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap