Conserved Protein Domain Family
SURNod19

?
pfam07712: SURNod19 
Stress up-regulated Nod 19
Statistics
?
PSSM-Id: 400177
View PSSM: pfam07712
Aligned: 23 rows
Threshold Bit Score: 505.69
Threshold Setting Gi: 162663434
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KRH42297      28 NVKTAVFLSPKFELGPGSVANKFDYDIDFPRGHIALKSFNAEVVDEAGNSVALHETYLHHWVVARYYQPKYVkth----t 103 soybean
KRH66581      32 HIKSATFVSKSFEVGPGKIVSKSFYDIEFPKGHIGVKSFDAELVDEDGNSVPLYETYLHHWFAIKYNENITMsr------ 105 soybean
KRH65728      32 HIKTTTFVSKSFEMGLGSIAAKTFEDIKFPKGHIGIKSFDAELVNQEGNSIPSYETYLYHWFAIKYHKNITMs------- 104 soybean
EFJ15746      25 RIQKKTYKSPAFALGPGEVQDR-HYELEFPKGHIGVKNFQGEVVDELGNPVPLSDVYLHHWVVFSLYVKSSErkelvrgg 103 Selaginella moe...
XP_014660890  38 RLKSMTVLSPPFFLRPGAVANKYYHDIAFPRGHVALKSFNGEVVDDRGAPVPLHEAYLHHWVVHPYYAA----------- 106 foxtail millet
XP_004974037  31 LLKSQTFLSPPIFLRPGSVSNKWYHDIAFPRGHLALKSFNAEVVDDHGVPVPLHETYLHHWLVEPYYAPKDG-------- 102 foxtail millet
EES15280      41 LVKSKTFLSPPIFLRPGDVADKIYYDIAFPRGHLAFKSFNGEVVDEHGVPVPLHETYLHHWVVEPYYAAKDA-------- 112 sorghum
VAI37566      29 VLKTQTFLSPPFFLRPGGVANKWYYDVDFPRGHVAIKSFNGDVVDEAGAPVPLHETYLHHWLVSPYYG------------ 96  durum wheat
KAB8109385    31 lLKSKTFLSPAFFLHPGSVSNKFYYDVPFPRGHLALKSFNAEVVDENGVPVPLHETYLHHWVVEPYYALKNS-------- 102 rice
XP_020195792  31 lLKSKTFRSPPILLGPGSVSNKYHHDVDFPRGHLAVKSFDAEVVDENGVPVPLHETYLHHWVAEPYYALKNS-------- 102 Aegilops tausch...
KRH42297     104 syDGHRILHNSDFVFVRNSGLCQRNTLGQYFGLGSETRGTATDVPDPFGIAVGDPAEIPEGYEEKWMFNIHAIDTRGVVD 183 soybean
KRH66581     106 -yIEKSHDISKGINYTRNDGACRGFLLPHYWGLGGESRGTSSNLPDPFAVEFGNPTNIPHGFKEKWLFDIMAIDTRGAYS 184 soybean
KRH65728     105 --LNPKLHRPEDAFFKRNEGTCNGGILSHYWGFRVESRGTSSNILDPFAIEQGNPTKIKKGYEEKWLFNIMVIDTRGAQD 182 soybean
EFJ15746     104 fhHGQDRLGSPSAIIAGNDGICQHNVLSQFWGLGSETRHTSYFVPGSYAIGVGNP---PEGYEELWVLNVHAIDTRGTYD 180 Selaginella moe...
XP_014660890 107 --TNATAAGRPATLPARNSGVCEGDTHGQYYGLGSETRRTATWVPDPYGVEAGDPAAPPEGYEERWMLNVHAIDTRGAAD 184 foxtail millet
XP_004974037 103 --AAGEARNRSKMIRHRNSGVC-SQTLGQYYGLGSETRHTATWVPDPYGIEIGDPAAAPEGYEERWLVNVHAIDTRGAVD 179 foxtail millet
EES15280     113 --STAAAEGRPRMIPARNSGVC-NHTLGQYYGLGSETRRTATWVPDPYGIEIGDPDAAPEGYEERWMLNVHAIDTRRVVD 189 sorghum
VAI37566      97 ----------PSTTPITNAGPC-KDSLGQYFGLGSETRRTATWVPDPYGIEIGN--GAPAGYEERWLINVHAIDTRGAAD 163 durum wheat
KAB8109385   103 --DSADAQKLPKGIIARNSGVC-KKTLGQYYGLGSETRHTATWVPDPYGIEIGNPEKPPEGYEEKWLINVHAIDTRGAID 179 rice
XP_020195792 103 --QSPDTQNLPKGMLKRNDGVC-KTTLGQYFGLGSETRHTATWVPDPYGIEIGNEDKAPEGYEEKWLLNIHAIDTRGVVD 179 Aegilops tausch...
KRH42297     184 KRGCTECKC-------ELYNVTKDAYGKPLMPDYKGGLKCCYDQTQCRLRE--GFEGPK------RSLYLRYTVKWVDW- 247 soybean
KRH66581     185 RKGCIECRCnllnlpkDFYNVTKDINEQPLSLNYKGGLFCCKDNLQCKLRK--GFHGPT------RKLSLRYKIKWVDW- 255 soybean
KRH65728     183 KKCCIECRCdhmnlpkDFYNVTRDIHNQPLTTNYKG-----------------GFQGSR------RMVSFRYKISWVDW- 238 soybean
EFJ15746     181 PQGCLECRC-------SLYNVTTDASGQPLKQGYKGGLHCCYEGTKCAVKP--GFQAPK------KTLYMQYTIEWVEW- 244 Selaginella moe...
XP_014660890 185 RMGCTECRC-------DLYNVTVDEHGRRIADDYAGGLLCCYDQTRCRVEE--GFVDGEa-----RKLFFRYTVMWLDWs 250 foxtail millet
XP_004974037 180 KLGCTECRC-------DLYNLTVDEFGRRIADDYAGGLLCCYDETRCKVEE--GFVDVEa-----RKVFLRYTVVWQDWs 245 foxtail millet
EES15280     190 KLACTECRC-------DLYNVTVDQYGRGIEDGYAGGLRCCYDETRCALEEraGLLVNAdeeappRKVFLRYTVMWQDWs 262 sorghum
VAI37566     164 KLACTECRC-------DAYNVTVDEDGSRIGNGYVGGTHCCYDSLRCRVED--AFANNGep---pRKLFLRYTVSWIDWs 231 durum wheat
KAB8109385   180 KLGCTECKC-------DLYNMTIDEYGRKLPKDYIGGLYCCYDETQCKVKE--GFNGEL------RKLFLRYTVTWLDWs 244 rice
XP_020195792 180 KPSCTECKC-------DFYNVTIDEYGRTISKNYTGGLFCCYDQTQCRVKE--GFNGEV------RKLFLQYTVTWLDWt 244 Aegilops tausch...
KRH42297     248 DKFLVPVKIYIFDVTDTIKISDDSGGMIPEHDCQIEYDVESCSt--DQKDGNGCLHVQKTSLPLQKGGYVIYGVAHQHSG 325 soybean
KRH66581     256 DEHQVPLKFYILDTTDRVR----TNGSTTIHDCQAEYTI-------PRIGHSDSPHVKKANIPMKKGGYLIYGTSHMHTG 324 soybean
KRH65728     239 NKHQVPVKVYILDSTNRIR----SNGSKIIHDCQVEYTI-------PENGDGDSPHVQKANIPIEKGGYLIYGTAHMHSG 307 soybean
EFJ15746     245 DECVLPVRAYIFDITDSRK----RDPIDRHVGCKVEYDVPACDp----sSNPDCIYQLENHLVIPKGGSIIYGVAHQHGG 316 Selaginella moe...
XP_014660890 251 D-AVVPVKIYIFDATHRPLPV----------GCKVEYEVEECSp--ERRAKNDCVHVQVAKQVVPRGGDLVFGVAHQHAA 317 foxtail millet
XP_004974037 246 D-AVLPVKIYIFDVTDRALLEGKTET-----ACRVEYLVEECSs--ENRAKNDCVHVQVAKQILPRGGDIVFGVAHLHSG 317 foxtail millet
EES15280     263 DAAVLPVKIYIFDVT----------------ACKVEYDVDECAagnDNGGGGECVHVQTATQVLPRGGDVVFGVAHQHSG 326 sorghum
VAI37566     232 DAVVVPVRIYILDVTDTALFDGSPKP-----YCKIEYRVDECSs--DDRASNNCVDMKTTKEMVSHGGDVVYAVAHLHRG 304 durum wheat
KAB8109385   245 DA-VVPVKIYIFDVTDTSPPDEKSGT-----ACKVEYQVEECSp--ENRAKNECIDVKVTKEVIPCGGDIVFGVAHQHSG 316 rice
XP_020195792 245 DA-VVPVKIYIFDVTDTAMLDGTPEH-----SCKVEYQVEECSa--ENRANNECIHTKTARAALPRGGDIVFSVAHQHSG 316 Aegilops tausch...
KRH42297     326 GTGSTLYGQDGRVICSSIPSYGKGKEAGNEADYIVGMSTCY-PRPGSVNIIDGETLTLESNYSSSREHTGVMGLFYLLVA 404 soybean
KRH66581     325 VVNATLYGQDGRVLCTSTPKYGTGKEAGNERGYLVGMSGCY-PKPGSIKIKDGEILTLETRYQN-KFRTGAMGFFYIHLA 402 soybean
KRH65728     308 IVNVTLYGQDGRTLCTSTPKYGRGNEAGNEKGYLIGMFVCY-PQPGSIKIHDGEILALESRYKN-EFCSGAMRHFYIYLA 385 soybean
EFJ15746     317 AMGMTMHGEDGRHLCSSIPLYGNGSTPGNEAGYVVGMSTCF-PEPGTVTVASGEKLHLSSSYSSAQEHTGVMALFYLIVs 395 Selaginella moe...
XP_014660890 318 GIGSSLHGQDGRLLCESIPTYGDGEEAGNEAGYIVGMSTCYhPAPGAVTVRDGETLTVVSNYSSERRHTGVMGLFYILVA 397 foxtail millet
XP_004974037 318 GIAASLHGEDGRLLCESTATYGDGQEAGNEADYIVGMSTCY-PKPGAVTVRDGEVLTVVSKYSSHQQHTGVMGLVYILVA 396 foxtail millet
EES15280     327 GIAASLHGEDGRLLCESTATYGDGEEAGNEAGYIVGMSTCY-PKPGDVKVRDGEALTVVSRYSSERRHTGVMGLFYILVA 405 sorghum
VAI37566     305 GLGSSLHGQDGRLLCKSMPIYGTGQEAGNEEGYVVGMSTCY-PEPGTVKVSDGEVLTMVSNYSSERQHTGVMGHFYILVA 383 durum wheat
KAB8109385   317 GIGASLHGQDGRLLCASIPSYGKGEEAGNEDNYIVGMSTCY-PKPGSVKVSDGEVLTVVSNYSSDRQHTGVMGLLYILVA 395 rice
XP_020195792 317 GVGASLHGQDGRLLCESLPTYGTGKEAGNEANYIVGMSTCY-PKPGSIKVSDGEVLTIVSNYSSDRQHTGVMGLVYILVA 395 Aegilops tausch...
KRH42297     405 EQ 406 soybean
KRH66581     403 EQ 404 soybean
KRH65728     386 EE 387 soybean
EFJ15746         --     Selaginella moellendorffii
XP_014660890 398 EH 399 foxtail millet
XP_004974037 397 EH 398 foxtail millet
EES15280     406 EQ 407 sorghum
VAI37566     384 DH 385 durum wheat
KAB8109385   396 EQ 397 rice
XP_020195792 396 EP 397 Aegilops tauschii subsp. tauschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap