2P19,2RA5,2FA1,2WV0,2OGG,3DDV,2IKK


Conserved Protein Domain Family
UTRA

?
pfam07702: UTRA 
Click on image for an interactive view with Cn3D
UTRA domain
The UbiC transcription regulator-associated (UTRA) domain is a conserved ligand-binding domain that has a similar fold to pfam04345. It is believed to modulate activity of bacterial transcription factors in response to binding small molecules.
Statistics
?
PSSM-Id: 400169
View PSSM: pfam07702
Aligned: 144 rows
Threshold Bit Score: 78.786
Threshold Setting Gi: 81722357
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P19_C   3 NANLDPKTRVLEHRLLAA-SSAIAEKLGVSAGDEVLLIRRLRSTGDIPVAILENYLPPAFN-DVSLDELEKGGLYDALRS 80  Corynebacterium gluta...
Q9I041  90 AQGRQPRTETLHAERRAA-GAWLAKRMGLEDSAPVYFLQRRRWVDERPVLIELIALDAGWCpGLLDHDL-DTSLMSLLRE 167 Pseudomonas aeruginosa
P0ACM9  91 EQGREPSWGFTEKNRTSDiPETLAPLIAVTPSTELYRITGWGALEGHKVFYHETYINPEVApGFIEQ-LENHSFSAVWEK 169 Escherichia coli K-12
Q7CR30  94 EQGREPKTALLSGVLTTV-PVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVpELLQYDL-NGSLTEVYES 171 Salmonella enterica s...
Q87JK9  86 AQNRVPKTELIAAKGTLA-NKQSARLLQLQPFSDVFRVDRVRYLEDRPVVYVTNYIRPEIFpNLLSFDL-TNSLTDIYRE 163 Vibrio parahaemolyticus
Q9KLZ1  86 AQNRQPKTELVSAKAVIA-NKQATRLLKLKPFSDVYRVDRVRYLDNRPVVYVTNYIRPELFpNLLDFDL-SQSLTDLYRE 163 Vibrio cholerae
Q87J98  96 EQHRIAATQLISVRSEMA-AGDYAKALDIEQMTPIHIIERLRCIDGRAVLFVENVLKASLFdGILAENL-TMSLTGIYRE 173 Vibrio parahaemolyticus
Q88M47  92 DQGRVASTELLSARLQPA-SAAICARLQLPALSSVVRVCRLRRIDGRAVLYAEHYLNPRYFpGILEHDL-AQSLTEIYGR 169 Pseudomonas putida KT...
Q9I4J3  92 DQGRVPETEVLGAAMIPA-SVDICQRLELPALSRVFQIRRARRVDGRLVLYVEHYLNPAYFpGIERFDL-TRSLTDLYAN 169 Pseudomonas aeruginosa
Q87YC4  92 AQGRVAHTQLLSARLQPA-SAMICEMLELPALSSVIQICRARRIDQRLVLYVEHYLRPELFpGILDHDL-NESLIELYAR 169 Pseudomonas syringae ...
2P19_C  81 -RGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVERVALDNSGQVIELGSHCYRPDMYN 141 Corynebacterium glutamicum
Q9I041 168 rFGLQPTRCQLAMHPTALNAAQAEPLQLAPGSPALYLERLSYAEGQRVVEFDQEFWRPDALE 229 Pseudomonas aeruginosa
P0ACM9 170 cYQKETVVKKLIFKPVRMPGDISKYLGGSAGMPAILIEKHRADQQGNIVQIDIEYWRFEAVd 231 Escherichia coli K-12
Q7CR30 172 hYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDLDIEYWRHDSLR 233 Salmonella enterica subsp. enterica ser...
Q87JK9 164 hFGVVYQKTRYRISTSTLLGEVAQALRATSGTPAMVVERTNYNQHGELIDCDIEYWRHDAIS 225 Vibrio parahaemolyticus
Q9KLZ1 164 hYATQYQTIHYRISTSSLLGEMAQALRATSGTPAMVVERVNYNQKGELIDCDIEYWRHDAIT 225 Vibrio cholerae
Q87J98 174 kYGYETMRSRFDVIPTSAPAHVAKALNLAEGQPVLKICRVNYKQDGELMDCELEYWRPDAVM 235 Vibrio parahaemolyticus
Q88M47 170 vYGIEYGQVCFEILPTALPVEAASALKVSAGSPGLHITRVNSDQHGHLIDCDLEYWRHDAIR 231 Pseudomonas putida KT2440
Q9I4J3 170 hYGIRYGRVRFEMVPTILPAEAAGPLRVSVGSPALQIVRVNRDQAGRLIDCDLEYWRHDALQ 231 Pseudomonas aeruginosa
Q87YC4 170 cYDVHYGPVRFDVVPTALHADAAAALKVSLGSPGLRIARVNYDRKDRLIDCDLEYWRHDAIH 231 Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap