Conserved Protein Domain Family
HNOBA

?
pfam07701: HNOBA 
Heme NO binding associated
The HNOBA domain is found associated with the HNOB domain and pfam00211 in soluble cyclases and signalling proteins. The HNOB domain is predicted to function as a heme-dependent sensor for gaseous ligands, and transduce diverse downstream signals, in both bacteria and animals.
Statistics
?
PSSM-Id: 400168
View PSSM: pfam07701
Aligned: 62 rows
Threshold Bit Score: 181.235
Threshold Setting Gi: 167533895
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001632464 230 KSMPLENFFNIFPFSFVISANMRISMAGHSLLSILg--KELLGAKVTDAFTLRRPK-TEFTWENLQVWRAA-FELVSNLP 305 starlet sea ane...
XP_004997927 203 aqLDATMTNRLFPWHFAVDKDMRIISLGKHLASRMk--KDCVGMHADKLFRIARPIdATWDFEDMRARCDKpFLFVTNPK 280 Salpingoeca ros...
EGD79412     203 idLGKSVTNDLFPWHFAFDRDMKIVSLGKHLAARFe--EPQAGKPFKKVFRMLRPVdISSEFDELKDVDGVsCLFSVDAK 280 Salpingoeca ros...
EGD78581     203 vdlpASVTNDLFPWHVAFDRDMNIVSVGKHLAGRFk--KQQLGAKAGSVFKIIRPShVRLKFDELMQAKDVpVLLSVDAK 280 Salpingoeca ros...
EGD74225     203 VAMPPSLTNDLFPWHVAFDRDMKIASLGKHLASRLk--RKQIGAQAWQVFKVVRPSsMRLKFDDMLQVQGApILLSVDAK 280 Salpingoeca ros...
EGD74224     203 vdLPTEVTNELFPWHVAFDRDMKIASVGKHLAARFk--KQQLGASASHVFKLVRPLgMSFSFDSLKTTQGApILLSVDAK 280 Salpingoeca ros...
PDM75245     191 PPITLRDFNRIFPYHICFNKQMVVEHVGVFLLNEYn-lADKKALKLTDIVQLIQPTdVQLTFKNIMTYLNTlFIFQLKVQ 269 Pristionchus pa...
Q6DNF3       221 ILVGLRDFKNIFPYHVCFNKQMIIEHIGIYLLREYg-lENKKTLKVSDLMQLVQPSdIQLTYKNVLSYLNTlFIFQLKHH 299 Caenorhabditis ...
EGT40607     217 IRLTHMDFVSTFPYHMVVDQDCKIVQVGRELYNHIpkdLLAVGTPLMRIFEVTRPQ-IPLDFDSICNFINAvFVLQVKTT 295 Caenorhabditis ...
P92006       224 LKVSLQDFSRALPYHFVLDESCRLVQCGDELYNHIpneLLQPGTPILRIFEINRPQ-IPLDFENICNFINAvFVLQVKTS 302 Caenorhabditis ...
XP_001632464 306 SIV-ETGAVRNIEKLQASYHQARTDFKRkKrldsnfngvqnkennfgyenripgrakelswikvdhrssgfgahglpiad 384 starlet sea ane...
XP_004997927 281 RML--------------SAEEYSAMLTErHqqrqlhllkqtnrahleeaetakevqlpsmvdvskphvrlvvneaaeedr 346 Salpingoeca ros...
EGD79412     281 LLR----------------DDDAHGLAS-Gmqgmslmgnggdmasdmrsslvs--------------------------- 316 Salpingoeca ros...
EGD78581     281 HLV--QPDSSDDASVSDNADTSVSSLSQqMprlqvtedsrgnqrrstaamsacpfss----------------------- 335 Salpingoeca ros...
EGD74225     281 HLT-----------HEVTVDESVVTLTHhLpqlqvtdpsgargsesstgcpfsgt------------------------- 324 Salpingoeca ros...
EGD74224     281 HVR-KLDQQQPQQPHQHVHDASSANTSHaGsqrptlgpdqladrgsavggcpfssm------------------------ 335 Salpingoeca ros...
PDM75245     270 SKR-NEEELAKKAGI----------------------------------------------------------------- 283 Pristionchus pa...
Q6DNF3       300 SKR-NEVQEGSSEA------------------------------------------------------------------ 312 Caenorhabditis ...
EGT40607     296 PMEfQRNANKRNAQNNDALENSNDDSMNaVvt------------------------------------------------ 327 Caenorhabditis ...
P92006       303 PLR-KKHMNAMTKEEREQEVEAMEEEVEsNe------------------------------------------------- 332 Caenorhabditis ...
XP_001632464 385 akesrttkrqetaknppeevrqakksekvgilsrvvdnlrcipmlidedgeevkdvaskngkrenksgfimsacdtvitt 464 starlet sea ane...
XP_004997927 347 nep----------------------------------------------------------------------------- 349 Salpingoeca ros...
EGD79412         --------------------------------------------------------------------------------     Salpingoeca ros...
EGD78581         --------------------------------------------------------------------------------     Salpingoeca ros...
EGD74225         --------------------------------------------------------------------------------     Salpingoeca ros...
EGD74224         --------------------------------------------------------------------------------     Salpingoeca ros...
PDM75245         --------------------------------------------------------------------------------     Pristionchus pa...
Q6DNF3           --------------------------------------------------------------------------------     Caenorhabditis ...
EGT40607         --------------------------------------------------------------------------------     Caenorhabditis ...
P92006           --------------------------------------------------------------------------------     Caenorhabditis ...
XP_001632464 465 edgvmlrngsttfvrddcdgndmyidtinkdvvwvkqtphirpsnarkyykspgthpverterlcrhknsnartyiqnqe 544 starlet sea ane...
XP_004997927 350 --------------------------------------------------------------------dadaqsqtdeer 361 Salpingoeca ros...
EGD79412         --------------------------------------------------------------------------------     Salpingoeca ros...
EGD78581         --------------------------------------------------------------------------------     Salpingoeca ros...
EGD74225         --------------------------------------------------------------------------------     Salpingoeca ros...
EGD74224         --------------------------------------------------------------------------------     Salpingoeca ros...
PDM75245         --------------------------------------------------------------------------------     Pristionchus pa...
Q6DNF3           --------------------------------------------------------------------------------     Caenorhabditis ...
EGT40607         --------------------------------------------------------------------------------     Caenorhabditis ...
P92006           --------------------------------------------------------------------------------     Caenorhabditis ...
XP_001632464 545 ksdkevcdslseeesdgvtvslpspskrrdsiysdspqdnvKKQPRIHLKGEMKYIKQNNKVLFVCSPVIGGFNEMMRCG 624 starlet sea ane...
XP_004997927 362 slvcpmsrrfdalsapslantsgstsrrssldaleqnsryiRKPTHIKLHGEIVYDEAKQVLLFVGNPLVQSLEELNKQG 441 Salpingoeca ros...
EGD79412     317 ------------------cassfrgsnasssdmlmmanrlyAKADNIKLHGQLTYNSDHDVVVFFGTPALRSLEEMEAQR 378 Salpingoeca ros...
EGD78581     336 ---------------pgsainstasskrssmdmmlraarlaRKVDNIKLHGQVTFHEASGVLLFVGVPALYSLEEMETQG 400 Salpingoeca ros...
EGD74225     325 ----------------sssfssntsskrssadmllraarltSKVDNIKLHGQITYHEESDLLLFVGVPALHSLEEMEAQG 388 Salpingoeca ros...
EGD74224     336 ----------------ssastsaasskrtsvdmmmraarltNKVDNIKLHGQVTYHEGSDLLLFVGVPALHSLEEMEAQG 399 Salpingoeca ros...
PDM75245     284 ------------------------------------------LNQPLSLKGQMMMLSGGNSIIFLASPHATSVRDILNVN 321 Pristionchus pa...
Q6DNF3       313 ------------------------------------------FQQPLVLKGEMMPINDGNSIIFICSPHVTTVRDILNLK 350 Caenorhabditis ...
EGT40607     328 ----------------------------------------lSQSQHLKLKGQMMLMSSGGHIMYLCSPYVTSIPELLQYG 367 Caenorhabditis ...
P92006       333 ----------------------------------------lTQGCHLKLKGQMMMLSTKKHIIYLCSPYVTSINELMQFG 372 Caenorhabditis ...
XP_001632464 625 VYMSDLGMHDRSQEMVLSGIQPLQQLEYARdQLLEKSRELEKNMKRVERERMRSNQLLYQMIPKQIADRL 694 starlet sea anemone
XP_004997927 442 IDLADMPIHCHGREVLYSAMCQAVSASNSN-QVEAKLADLDRSMIEVQEKKEQIDALLSSILPENVANAL 510 Salpingoeca rosetta
EGD79412     379 IELSEMPLHSHGREFLYGSMFQSASAKNSN-EVDRRMAELDQSMLEIQDKKKQIDGLLHSILPPVVASSL 447 Salpingoeca rosetta
EGD78581     401 ISLSEMPLHSHGREVLYGSMFQSASAKNTN-EVDKRMAELDRSMLEVQEKKEQIDTLLHSILPPVVASAL 469 Salpingoeca rosetta
EGD74225     389 INLTELPLHSHGREFLYGAMYQSASAKNTN-EVDKRMAELDHSMLEVQQKKEQIDALLHSILPPVVASSL 457 Salpingoeca rosetta
EGD74224     400 INLTELPLHSHGREFLYGAMFQSASAKNTN-EVDKRMAELDHSMLEVQQKKEQIDALLHSILPPVVASSL 468 Salpingoeca rosetta
PDM75245     322 LFISDMPMHDATRDLIMLNQSRMCQMELNK-RLEETSKKMKGCAEELEKRKTQTDHLLFQFVPQQIAEAL 390 Pristionchus pacificus
Q6DNF3       351 LYISDMPMHDATRDLVMLNQSRICQMELNK-KLEETMKKMKKMTEELEVKKSQTDRLLFEFVPPVIAEAL 419 Caenorhabditis elegans
EGT40607     368 LRLTAMPLHDATRDLILLNQQRLSDVEMNL-QLEANNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQL 436 Caenorhabditis brenneri
P92006       373 MRLTAMPLHDATRDLILLNQQRLSDVEVNL-QLEANNEQLETMTHELEVERQKTDSILKDMLPRKIAKQL 441 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap