5N8Y,1V2Z


Conserved Protein Domain Family
KaiA

?
pfam07688: KaiA 
Click on image for an interactive view with Cn3D
KaiA C-terminal domain
The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria. The overall fold of the KaiA C-terminal domain is that of a four-helix bundle, which forms a dimer in the known structure.
Statistics
?
PSSM-Id: 400159
View PSSM: pfam07688
Aligned: 24 rows
Threshold Bit Score: 207.108
Threshold Setting Gi: 49259470
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N8Y_P           162 ERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELM 241 Synechococc...
CAK28729         150 ERIGFLGVFYKRDPRLFLRNLPTDERSELLASLERSYRDVLLSYFRDPPAANQAIESFVNTAFFCDLAITRAVEIHMKLI 229 Synechococc...
BAG02995         158 ERLGYLGVYYKRNPQLFYRNLAPEEKKELLREVRADYREIILNYFQQDYPINQAIDELVNNVFFTDLSVSQILEIHMELM 237 Microcystis...
jgi:Sta7437_0362 190 ERLGYLGIYYKRNSQDFYRNLSQAKKQELFRQLSSEYRQIILSYFNEEQDINKLIDQFVNQAFFADLSVSQILEMHMELM 269 Stanieria c...
jgi:Cyast_1578   184 ERLGYLGVYYNRKTDYFYRNLSNEERQQLLKQLGAEYREIIILYFGQENEVNQLIDQFVNQCFFADLSVSQILEIHMELM 263 Cyanobacter...
jgi:PCC8801_4233 172 ERLGYLGVYYKRNPKDFYRNLSPNEKKQLIAQLRAEYREIILNYFGDNIDVNQLIDQFVNQAFFSDISVSKVLEIHMELM 251 Rippkaea or...
jgi:Cha6605_0650 177 ERLGYLAVYYRRNPSQFFRHLDRRQKQELLDALKLQYRHIVLEYFADSTQIDLQIDEFVSAVFFRDLAVSEIVKIHMELM 256 Chamaesipho...
jgi:Cri9333_1675 182 ERLGYLAVYYKRSPQNFFRNLSPNEKTLFLDNLKSKYCEIILTYFDNDPKLNQEIDDFVNLGFFADLSVSQIVEIHMELM 261 Crinalium e...
WP_009768406     168 ERLGYLGVYYKRDPKNFFRHLPPEQKHQLLEKLKTDYRDIVLRYFANDGTLNQRIDDFVNTAFFTDVSAAQIVEIHMELM 247 Oscillatori...
jgi:Mic7113_0272 183 ERLGYLGVYYKRNPQLFLRHLPPSERQKILENLKSEYRQIVLKYFSQDNTLNQRIDNFVDKSFFADISVSRIVEIHMELM 262 Microcoleus...
5N8Y_P           242 DEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRE 283 Synechococcus elongatus
CAK28729         230 DGWSKQLALEGHKSDFLQDYRLALLDVMAHLCEMYRRSIPPE 271 Synechococcus sp. RCC307
BAG02995         238 DEFSQQLKLEGRSEEILLDYRLALIDILAHLGEMYRRSIPRE 279 Microcystis aeruginosa NIES-843
jgi:Sta7437_0362 270 DEFAQQLKLEGRNEEILLDYRLALIDIIAHLCEMYRRSIPRE 311 Stanieria cyanosphaera PCC 7437
jgi:Cyast_1578   264 DEFAQQLKLEGRNEEVLLDYRLALIDIIAHLCEMYRRSIPRE 305 Cyanobacterium stanieri PCC 7202
jgi:PCC8801_4233 252 DEFSQQLKLEGRSEEILLDYRLTIIDILAHLGEMYRRSIPRE 293 Rippkaea orientalis PCC 8801
jgi:Cha6605_0650 257 EEFSDQLKLEGRSEEILLDYRLTLIDIIAHLCEMYRRSIPRE 298 Chamaesiphon minutus PCC 6605
jgi:Cri9333_1675 262 EQFSQQLKIEGRSEEILLDYRITLIDIISHLCEMYRRSLPKE 303 Crinalium epipsammum PCC 9333
WP_009768406     248 DEFSKQLKLEGRSEEILLDYRLTLIDTIAHLCEMYRRSIPRE 289 Oscillatoriales cyanobacterium JSC-12
jgi:Mic7113_0272 263 EEFSKQLKLEGRSEDILLDYRLTLIDVIAHLGEMYRRSIPRE 304 Microcoleus sp. PCC 7113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap