6QNE,6QPA


Conserved Protein Domain Family
SOR

?
pfam07682: SOR 
Sulphur oxygenase reductase
The sulphur oxygenase/reductase (SOR) of the thermo-acidophilic archaeon Acidianus ambivalens is an unusual enzyme consisting of 24 identical subunits arranged in a perfectly symmetrical hollow sphere and containing a mononuclear non-heme iron centre (personal communication: A. Kletzin). At 85 degrees C in vitro, elemental sulphur is oxidized to sulphite, thiosulphate and hydrogen sulphide with no external cofactors needed. The proposed equation is: 4S + O2 + 4 H2O ---> 2 HSO3- + 2 H2S + 2 H+.
Statistics
?
PSSM-Id: 400154
View PSSM: pfam07682
Aligned: 11 rows
Threshold Bit Score: 435.296
Threshold Setting Gi: 430010097
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6QNE_A              3 KPYVAINMAELKNEPKTFEMFASVGPKVCMVTARHPGFVGFQNHIQIGILPFGNRYGGAKMDMTKES------------- 69 
AGA34359            8 GAALAINQAAVANDPQTFEKMGHIGPKVCLTTANEPGFLGFHAFLQTGTHPLGGRFGAAQVVTADSLeavies-phnlrl 86  Thioalkali...
WP_012824092        5 NPIIAINMAKIANKPDSYETMMKVGPKVCITTASHPGFLGFEQLLQTGIHPMAGRYGGGAVDMRETL------------- 71  Halothioba...
jgi:Dbac_1171      10 pIYVALNMSKVVNNEESFDLMHKVGPRVCITTATHPGFLGFMANIQTGILPLAGRYGGGSTHMENAL------------- 76  Desulfomic...
AGA32849           24 pLYVAINRVLVENNPNLMRMMRQASSEMCLATALTPGFRGFDLMRQTGSCPMGMRWG-ASTDMTQEL------------- 89  Thioalkali...
jgi:Sulac_0370      3 VPYIAVNKARVLNAPSSFETFTSVGPKVCMVTANHEGFVGFQNHVQVGVFPMGGRYGAAKMDMHEEL------------- 69  Sulfobacil...
Q6L0W6              3 KPYVAINIVEMLNNETTMNMFQQVGPKVCMVTARHPGFVGFQNHVQFGVIPLGTRYGGASMDMTK-M------------- 68  Picrophilu...
RogerUC:Ahos_0131   1 -------MAELKNEPKTFEMFASVGPKVCMVTARHPGFVGFQNHIQIGILPFGNRYGGAKMDMTKES------------- 60  Acidianus ...
Q972K4              3 KPYVAINMVEVRNDPKTLELFGKVGPKVCMVTARHPGFVGFQNHVQIGVVPLGTRWGGAKMEMSQEM------------- 69  Sulfurisph...
O66762              8 GVAVAINKAKVNNTPRFQELMYQVGPKVCITTAMHEGFLGFHAFIQVGAHPLGGRFGAAKVINADSLeaiqregltaiky 87  Aquifex ae...
6QPA_A              5 NPIIAINMAKIANKPDSYETMMKVGPKVXITTASHPGFLGFEQLLQTGIHPMAGRYGGGAVDMRETL------------- 71 
6QNE_A             70 STVRVLQYTFWKDWKDHEEMHRQNWSYLFRLCGSCASQMIWGPWEPIYEIIYANMPINTEMTDFTAVVGKKFAEGKPLd- 148
AGA34359           87 NPLNLWQYTLWEDAESHERMHYEQYDRIFELCAGCLDMVVDGPWEPVYTIAEANMPPIIGMTDVPRVMGQAFARQQEP-- 164 Thioalkali...
WP_012824092       72 NPMGMFQYTVWKDVHSHEEMHHDNFKEIFELCSGCLGMVIEGPWEPYFEVVKSDLPQIMSMTDVPQVLGDSFAKQERV-- 149 Halothioba...
jgi:Dbac_1171      77 NPVRNYQYTMWKHWKDHDEFHEKQFSRIFELCTSCLEMVVEGPWEPVYSVIHAKMPTVRSMGQIAD-LGKDFVQQKDF-- 153 Desulfomic...
AGA32849           90 SHIWIDQFTYWDTLDAHEEFHETFEDVVVTACDKCGNVLLDGPEEPVYRIVASHLPRLVSLNQ--------FEQARAQer 161 Thioalkali...
jgi:Sulac_0370     70 NPIGIVQYTMWRHWEDHEAMHYENFDSIFRLCSQCLNMVVEGPWEPLYEIVAHDLPENVSMTDVPAALGAAWMAGQPV-- 147 Sulfobacil...
Q6L0W6             69 STMNVYQYTMWKNIKDHEDMHRENFSSIFRLCSSCLSQVVYGPWEPLFEIVDADMPLNTDMMDFTVMFGKKFAAGDPSg- 147 Picrophilu...
RogerUC:Ahos_0131  61 SSVRVLQYTFWKDWKDHEEMHRQNWSYLFRLCYSCASQMIWGPWEPIYEIIYANMPINTEMTDFTAVVGKKFAEGKPLd- 139 Acidianus ...
Q972K4             70 HSLMLMQYTFWKNWKDHEEMHKQNWANLFRLCLQCADQMIWGPYEPLYEIVYANMPLNTEMTDFTVMVGKKFAAGEAVs- 148 Sulfurisph...
O66762             88 NPLELWQYTVWEKWEDHEEMHYQQFDRIFELCVGCFTEVVEGPNEPIYVVREANMPPVIDFTDVPKVLGESMMQAMQGkg 167 Aquifex ae...
6QPA_A             72 NPMGMFQYTVWKDVHSHEEMHHDNFKEIFELXSGCLGMVIEGPWEPYFEVVKSDLPQIMSMTDVPQVLGDSFAKQERV-- 149
6QNE_A            149 -iPVISQPYgKRVVAFAEHSVIPGKEKQFEDAIVRTLEMLK-K-APGFLGAMVLKEIGVSGIGSMQFGAKGFHQVLENPG 225
AGA34359          165 --PKVRLAM-RRLVALGEHHVREGHEQAFLEGAVKTLELLQ-EhAPGMIGWMILEKQGEAALSTFQLEPPAFWESLQTLG 240 Thioalkali...
WP_012824092      150 --PKVALSS-QRTVVIGDHWVMDGHEKAFEQGATETLEWMK-AnVPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLG 225 Halothioba...
jgi:Dbac_1171     154 ----IRFATpQRCVAIGEHTVAPGKEKAFEKGAIETMEALS-D-ATGFLGYMILKQIGVCALGSFMLDPTSMAETLQTLG 227 Desulfomic...
AGA32849          162 diGHLAVDSgETVTVLATHIVRPGKEAEFEEGEIRTMELLR-E-SNGMIGYQILKRVGISTLGSGHATVESIMERMK--- 236 Thioalkali...
jgi:Sulac_0370    148 --PAVSLPYgQRIVAASDHTVIPGREKDFEQAIVDVMTAFK-K-APGFLGYMVMKQIGASAIGAMQLTPQGIHQALQTRG 223 Sulfobacil...
Q6L0W6            148 -vPPISQPYgRRTIALSEHTVKKGMEKDFESNIVEVMKDFR-N-APGFLGYMILKEVGVSAVGSFQLKSQGIHEALESNG 224 Picrophilu...
RogerUC:Ahos_0131 140 -iPVISQPYgKRVVAFAEHSVIPGKEKQFEDAIVRTLEMLK-K-APGFLGAMVLKEIGVSGIGSMQFGAKGFHQVLENPG 216 Acidianus ...
Q972K4            149 -iPPISQPYgKRVVAFGEHIVKEGLENQFEEYAIKTLEAFR-S-APGFLGGMILKEIGVSPLGSLQLNAKGFHQILETAN 225 Sulfurisph...
O66762            168 giPKVRLLT-QRIAVVGIHKVKEGMEEKFIEGAVETLELLN-KySAGMIGWMILEKIGESPYGTFQIKPPEFWEVVASRG 245 Aquifex ae...
6QPA_A            150 --PKVALSS-QRTVVIGDHWVMDGHEKAFEQGATETLEWMKaN-VPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLG 225
6QNE_A            226 SLE-PDPNNVMY--------SVPEAKNTPQQYIVHVEWANTDALMFGMGRVLLYPELRQVHDE-VLDTLVY-GPYIRILN 294
AGA34359          241 ANP-PKSRRTNFgefgkdytSPPIPIGGPKEYQVHMEWESPDALTFGLALTGVNPKLRRIHDEgVLAHLAKlPPYYRVFA 319 Thioalkali...
WP_012824092      226 ANP-PEY-NTNYgnk--vhdKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNNgVLAHLDK-GPYYMFFS 300 Halothioba...
jgi:Dbac_1171     228 ANP-PKKPRPLF--------KTLDAMPRPPEYLIHSEWDATEMAQMGFAKVLVNHAIRKIHDDgVMAHLIR-GPYIMFFQ 297 Desulfomic...
AGA32849          237 DTPdAKLQRTA---------EVWEGYTIPAEYLVMVEWESLHAAQRGMPHVNVKPDILFVHGPkVFNNCVR-MPTVRMAV 306 Thioalkali...
jgi:Sulac_0370    224 DNP-PRDKEGNF--------QPMQAHSSPQEYVVHMEWADMNSAMMGISRVVVNHKMRMIHDr-VLETVLK-GPYVTLWN 292 Sulfobacil...
Q6L0W6            225 EV--PQHQEGAF--------SYEEARPTPPEYFVHMEWATPQDAQFGIARVLFKHETRVLHDk-VLDTLIK-GPYIRLLN 292 Picrophilu...
RogerUC:Ahos_0131 217 SLE-PDPNNVMY--------SVPEAKNTPQQYIVHVEWANTDALMFGMGRVLLYPELRQVHDe-VLDTLVY-GPYIRILN 285 Acidianus ...
Q972K4            226 GMDvPEP-VTIY--------EAPEFRNRPQRYIVHTEWSDTNALMFGLGRVLIYPEVRQIHDk-VLDTLVY-GPYIRVLN 294 Sulfurisph...
O66762            246 AVP-PKTRETIWgeyg-kpeFQLEPAGHPKEFIVHMEWSRPESAMFGPALTAVNPKIKKVHDEkVMTTLAHiPPYYKVFM 323 Aquifex ae...
6QPA_A            226 ANP-PEY-NTNYgnk--vhdKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNNgVLAHLDK-GPYYMFFS 300
6QNE_A            295 PMMEGTFWR 303
AGA34359          320 PAMEDMIFF 328 Thioalkalivibrio nitratireducens DSM 14787
WP_012824092      301 PMMEQGLWR 309 Halothiobacillus neapolitanus
jgi:Dbac_1171     298 PMMEEPGWR 306 Desulfomicrobium baculatum DSM 4028
AGA32849          307 SMFAEQTYR 315 Thioalkalivibrio nitratireducens DSM 14787
jgi:Sulac_0370    293 PIMEDTSWR 301 Sulfobacillus acidophilus DSM 10332
Q6L0W6            293 PMMEGTSWR 301 Picrophilus torridus
RogerUC:Ahos_0131 286 PMMEGTFWR 294 Acidianus hospitalis W1
Q972K4            295 PMMEGTYWR 303 Sulfurisphaera tokodaii
O66762            324 PLMEDLILF 332 Aquifex aeolicus
6QPA_A            301 PMMEQGLWR 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap