2DM3,2XY2,4C4K,1WIT


Conserved Protein Domain Family
I-set

?
pfam07679: I-set 
Click on image for an interactive view with Cn3D
Immunoglobulin I-set domain
Statistics
?
PSSM-Id: 400151
View PSSM: pfam07679
Aligned: 48 rows
Threshold Bit Score: 72.6753
Threshold Setting Gi: 66773952
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DM3_A              10 PHFLQAPGDLTVQEGKLCRMDCKVSGL-PTPDLSWQLD--GKPVRP------------DSAHKMLVREn-----GVHSLI 69   human
O15146             121 PKITRPPINVKIIEGLKAVLPCTTMGN-PKPSVSWIKG--DSPLRE------------NSRIAVLESG---------SLR 176  human
FlyBase:CG2198-PA   25 PVISQISKDVVASVGDSVEFNCTVEEV-GQLSVSWAKRpsESDTNSvvlsmrnilslpDQRYNVTVTEgpktgsAIYTFR 103  fruit fly
Q96RW7            1171 PKIQRGPKHLKVQVGQRVDIPCNAQGT-PLPVITWSKG--GSTMLV------------DGEHHVSNPD--------GTLS 1227 human
2XY2_A               3 LQVTISLSKVELSVGESKFFTCTAIGE-PE-SIDWYNPq-GEKIIS------------TQRVVVQKEG------VRSRLT 61   human
O00557              20 LQVDIVPSQGEISVGESKFFLCQVAGDaKDKDISWFSPn-GEKLTPn-----------QQRISVVWNDd-----SSSTLT 82   human
4C4K_O               5 PRFLTRPKAFVVSVGKDATLSCQIVGN-PTPQVSWEKD--QQPVAA------------GARFRLAQDG------DLYRLT 63   human
Q62234            1555 RVLGGLPDVVTIQEGKALNLTCNVWGD-PPPEVSWLKN--EKPLTS------------DDHCSLKFEAg-----KTAFFT 1614 house mouse
O55124            1345 KVIGGLPDVVTIMEGKTLNLTCTVFGN-PDPEVVWFKNdkDIELSE--------------HFLVKMEQs-----KYVSLT 1404 house mouse
Q92626             433 PQFTVTPQDRVVIEGQTVDFQCEAKGN-PPPVIAWTKG--GSQLSV------------DRRHLVLSSG---------TLR 488  human
2DM3_A              70 IEPVTSRDAGIYTCIATNR-AGQNSFSLELVV 100  human
O15146             177 IHNVQKEDAGQYRCVAKNSlGTAYSKVVKLEV 208  human
FlyBase:CG2198-PA  104 IQNIEVSDMGPYECQVLVSaTEKVTKKLSLQI 135  fruit fly
Q96RW7            1228 IDQATPSDAGIYTCVATNI-AGTDETEITLHV 1258 human
2XY2_A              62 IYNANIEDAGIYRCQATDAkGQTQEATVVLEI 93   human
O00557              83 IYNANIDDAGIYKCVVTGEdGSESEATVNVKI 114  human
4C4K_O              64 ILDLALGDSGQYVCRARNA-IGEAFAAVGLQV 94   human
Q62234            1615 ISGVSTADSGKYGLVVKNK-YGSETSDFTVSV 1645 house mouse
O55124            1405 IQGVTAEDSGKYSINVKNK-YGGEKIDVTVSV 1435 house mouse
Q92626             489 ISGVALHDQGQYECQAVNI-IGSQKVVAHLTV 519  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap