Conserved Protein Domain Family
Eco57I

?
pfam07669: Eco57I 
Eco57I restriction-modification methylase
homologs of the Escherichia coli Eco57I restriction-modification methylase are found in several phylogenetically diverse bacteria. The structure of TaqI has been solved.
Statistics
?
PSSM-Id: 369456
View PSSM: pfam07669
Aligned: 17 rows
Threshold Bit Score: 101.608
Threshold Setting Gi: 81555879
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006194345  552 FDIVIGNPPYIRIQalkEWAALEVEfyqekyvsakkgNYDIYVIFVEKGLNLLtkDGRLGFILP-HKFF--NAQYGELIR 628  Nodularia spu...
Q5FLR4       1149 FDVVIGNPPYQEPTnkkTVSGQQP-------------VQNIFQYFQELADNMG--VKYSSLIYPgKRWIhqSGKGLRKFG 1213 Lactobacillus...
Q5M3M3       1118 FDVVIGNPPYQESTndkMMKTGQQKr-----------VRNVFQDFQLVADEVS--QNFSCLIYPgGRWIhrSGKGMKEFG 1184 Streptococcus...
Q8A0K8        987 INAIVGNPPYQEVVaqkETANGQKV------------SVSIFQYFQTISDRLG---RYTSLIYPgARWIhrSGKGLEQFG 1051 Bacteroides t...
Q7MU60        984 IDAIIGNPPYQVMN---QGK--GNG------------SDPIYHKFFDLAMVLA--PQGT-LIHP-ARFLfnAGKTPKEWN 1042 Porphyromonas...
Q03N29       1141 FDVVIGNPPYQEES---KGD--SSS------------QKPIFNYFMDLSYGLA--DKAV-LITP-AKFLsnAGGTPKSWN 1199 Lactobacillus...
Q82YQ3        262 FDVIIGNPPYQEEN----TE--RNR------------DDAIYHLFLDEAYKIA--EKVV-MITP-ARFLfnVGSTPKIWN 319  Enterococcus ...
Q8DPM0        291 FDVVIGNPPYQETG--------EAR------------DEPIYHYFIDEAYKIA--DKSI-LITP-ARFLfkAGQTPKNWM 346  Streptococcus...
P75561        250 FDVIIGNPPYQLANnrgGDAGDGNG------------ANPIFQEFILRALELQ--PKYLAMIVP-ARWInsSEKVFLKFR 314  Mycoplasma pn...
P75451        250 FDVIIGNPPYQLSN---GSGSDGNG------------AKAIFQDFVLKAIDLE--PKYLAMIIP-AKWMisAENIFLNLR 311  Mycoplasma pn...
WP_006194345  629 GFIAENKSLNQIIHFGDKQ-VFTDATTYTCLLFLSKQK 665  Nodularia spumigena
Q5FLR4       1214 YDLINDPHLARLILFEDSNqVFSDVSIPDGISIVFKDY 1251 Lactobacillus acidophilus
Q5M3M3       1185 LRQINSPHLAKLFYYPNAEeIFKDVAIADGISVVVKDF 1222 Streptococcus thermophilus LMG 18311
Q8A0K8       1052 LTQINDPHLCFLKFFPDSMdVFKEVGIADGLSIVMKDT 1089 Bacteroides thetaiotaomicron
Q7MU60       1043 EKMLSDKHYRVVDYWPNSAeVFPTVDVKGGIATSYWNK 1080 Porphyromonas gingivalis
Q03N29       1200 EKMLHDPHLKVIYFEKKSAnIFPRTDIKGGVVVTLRDE 1237 Lactobacillus brevis ATCC 367
Q82YQ3        320 EKMLNDKHLSVEMYERKSEkIFPNTSIIGGIAVTYRDA 357  Enterococcus faecalis
Q8DPM0        347 EKMLEDKHLKVQFYELKSGkVFTGTDIKGGVAITYRDV 384  Streptococcus pneumoniae R6
P75561        315 AKLQKSNGFKGINIFFDSKhCFPNRQIKGGVCYFNWQN 352  Mycoplasma pneumoniae M129
P75451        312 DKLKKNKDIKEINIFFDSKdCFPKREIKGGICYFIWQN 349  Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap