Conserved Protein Domain Family
EIIBC-GUT_C

?
pfam07663: EIIBC-GUT_C 
Sorbitol phosphotransferase enzyme II C-terminus
Statistics
?
PSSM-Id: 400144
View PSSM: pfam07663
Aligned: 23 rows
Threshold Bit Score: 123.936
Threshold Setting Gi: 496593821
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009289142   86 LSPIIGPGAVIPQVIGALIGGLISTGAVPLTMALPTVFTIHQPCGADFIPVGMSLCEAEPETVEVGVSAVLFSKFIVAPI 165 Anaerostipes
WP_013378527  231 ISPLVGSGALIGQVLSVLVGYGIMIGAFPVVLALPALFAVDAQVGCDFIPVGLSMGDAASDTVDIGVPSVLLSRLFTGPI 310 Clostridiales
WP_009291051  237 LSPVLGPGAVIAQVVGVLLGVEIGKGTIPIAYSLPALFAINSQVGCDFVPVALTLAEAEDETVSAGVPAMLFTRLVTGPA 316 Anaerostipes
WP_013669786  246 LSPLLGPGAVISQIVGTLIGVEIGKGNIPPQLALPALFAINTQNGCDFIPVGLGLAEASSETVEVGVPAILYSRFLNGVP 325 Aerococcus urinae
WP_005343759  243 LSALLGPGAVIAQIVGTLIGTEIGKGTIAPQLALPALFAINCQGACDFIPVGLGLAEAEPETIEVGVLSVMYSRFLTGWI 322 Anaerobutyricu...
jgi:Tola_0243 234 LSPFLGPGAVIAQVIGVLVGTQIGMGNIPPQLALPALFAINAQAACDFIPVGLSLAEAKPKTVQIGVPSVLYSRFLTGAP 313 Tolumonas auen...
WP_005228107  242 LSPVLGPGAVIAQVVGVLLGVEIGKGTIAPAMALPALFAINSQAGADFTPVGLTLAEAEPYTVEVGVPAVLFSRLLTGPL 321 Enterococcus c...
Q9KES7        242 LSPLLGPGAVIAQVVGVLIGVEIGRGNIPPSLALPALFAINPQVGADFVPVGLTLGEAKPETIEVGVPAVLMSRLITGPL 321 Bacillus halod...
WP_012863189  244 fSPLLGPGAVIAQVVGVLVGTQIGLGTIPASLALPALFAIDPQVGCDFIPVGLSLGDAEAETIEVGVPAILFSRLVTGPL 323 Sebaldella ter...
EPS46774       79 LSPFLGPGAVIAQVIGVLIGVEIGKGNIPPHLALPALFAINSQAACDFIPVGLGLAEAEPETVEVGVPSVLYSRFLTGPT 158 Clostridium bo...
WP_009289142  166 EIIIAVIVGQL 176 Anaerostipes
WP_013378527  311 MVLIAYFVATM 321 Clostridiales
WP_009291051  317 AVLVAYLLSFG 327 Anaerostipes
WP_013669786  326 RVLVAWLASIG 336 Aerococcus urinae
WP_005343759  323 RVLIAYAASFG 333 Anaerobutyricum hallii
jgi:Tola_0243 314 TVLLAWFVSFF 324 Tolumonas auensis DSM 9187
WP_005228107  322 AVILAWLASFG 332 Enterococcus casseliflavus
Q9KES7        322 AVVLAYLFSIG 332 Bacillus halodurans
WP_012863189  324 SVVLAYIASIG 334 Sebaldella termitidis
EPS46774      159 SVFIAWLASFG 169 Clostridium botulinum A1 str. CFSAN002368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap