Conserved Protein Domain Family
DUF1577

?
pfam07614: DUF1577 
Protein of unknown function (DUF1577)
A family of hypothetical proteins in Leptospira interrogans.
Statistics
?
PSSM-Id: 369443
View PSSM: pfam07614
Aligned: 8 rows
Threshold Bit Score: 232.684
Threshold Setting Gi: 81472465
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8F7M4                30 NLVKHLFYYLKADEVEFPFD-YDGQRFFAVVENIEETTVNLRISGATQGLTLRAKISFEIMNILYQFEVIILEFMEDSIV 108 Leptosp...
Q8F8I0                19 QKDHVITKYLLDKELVFKID-PFDRKAVIKKVLEEGEKIIIQVSKEEDLPKENSFILYTILAKYIQLECILLQKLENSLF 97  Leptosp...
Q8F713                21 QRKHIIEKHLLNQSLRIKGD-LNRETITIQRYVDSGEKIIAGISDETHFSENDEIVLYKILAKYVQLECSFIRKTRPGVA 99  Leptosp...
WP_012389661          12 QKNHVILHYLMNQEMKASWN-GQVQTMTVLQEVPGGEEIILQWSEIWPIGEGSTIVLSKLLARYLELHCVFVKQLAPHKI 90  Leptosp...
Q8F9Y2                23 KIKYILKEYIHFQGLLVKES-PFHQELKPMEIREDGTFIFPIDSTLTNI--NDELVLYRTLSKHIEISFDVIEKT-DTQI 98  Leptosp...
instpast:LEPBI_I0868  30 NIVKHLFYYLKADNREFEFI-YEEDNLVAAVEEIEAHSVTLMIPDLVEKGSRRARVRFEVMNINYQFEVVILD-IQKEQI 107 Leptosp...
instpast:LEPBI_I1271  19 KKLHVLTKFLLNQELNLKDDiHSGESCYLKKVSQDGNKILVSVRPTITLSVGQKITLYKILGRYLHLECTVEQEKGESQY 98  Leptosp...
Q8F4Q5                19 KKFHIISKFLVQTDIIAQTSnSLKQIVKILQVSKDATKILVQTQTPNALPLNSHVTLAKLLAKYVELSCEVIDEKPNNQF 98  Leptosp...
Q8F7M4               109 QIRIPSELQAASFRKNVRVAVDDLFMnYVILFRSlsgggreiGRNIQVEQRFNSLmreikkdnpdlRLINIIISEYISNI 188 Leptosp...
Q8F8I0                98 IIKVEKLAIARKNRETQRFQVESDTM-YVTNVVS--------SKTVIEANMFNIP-----------TLVKVNFEDFKNRL 157 Leptosp...
Q8F713               100 EFSVNKVSIAKSNRAFPRYSVAEDAA-HVTNINS--------SKTVIDASLFNIP-----------TLVKVSFEDYKTKL 159 Leptosp...
WP_012389661          91 QLRVEKVLIAKKERLNPRFSITEEGMvNVTNIVS--------SKTIIEANMFNIP-----------TLVRVNFEDYRKRM 151 Leptosp...
Q8F9Y2                99 ICKPLFARIAKAKRMSPRI---EGLM----------------GKVI--AHKFLIPrkeldiakvlgTSGQIILNDLNRKV 157 Leptosp...
instpast:LEPBI_I0868 108 VIKTPTELQSYQLRTNKRIPVDDLFMnFIILFRSlsggsrevGKNLYAESRFPHLmkevrkdrpdsKLINIMLTEAIERI 187 Leptosp...
instpast:LEPBI_I1271  99 VLQLNKIAIAKKDRESSRIPVPPGSA-WITNVVS--------SKAKIETDMFHVP-----------TAVKVNFQDFETKL 158 Leptosp...
Q8F4Q5                99 ILSVSEISIASKERSLNRIVPPEGTV-WITNIRT--------SKTTIDANLFNIP-----------TSVKVNFADYETKL 158 Leptosp...
Q8F7M4               189 SREY----EIVFFSQHREETflDSFVRR----HDRPVFIPDTSLIINYIREDdgsesiggnyrEEYMRMVLENg-QDYAD 259 Leptosp...
Q8F8I0               158 KQKTndtvNIDTFGPGLNHK--FEIVKK----TLKYLLLENTQDPNSYKNNS-----------PGRIHYEKEI--DDDLD 218 Leptosp...
Q8F713               160 KPDQlglvEIDVFRSDQDEK--FELIKR----TKKYIHIENTSLEESYKSKS-----------ENQVDVEDEI--HEEIP 220 Leptosp...
WP_012389661         152 MVRSgeagTMDIFKSGMERK--FDVVKS----SQKILFIKDATSPESYKMDA-----------EGFLNYEDDI--EDNVD 212 Leptosp...
Q8F9Y2               158 KQIYp--sSKLVFNSSKELSpeEELVKK----YKKPIYIRDTSTLDSNPEGEfa--------nLDLLPIKETLqeELILE 223 Leptosp...
instpast:LEPBI_I0868 188 SKDY----EIHFFKEDEKLNefDDFIKKtilqTSKTIYISDCNRITSYINEPndevl--fnyfSEHKEMAKELg-DEFAL 260 Leptosp...
instpast:LEPBI_I1271 159 KNSVdf-iKISTFNSREDNEv-IRQIKK----TKKGLLLEDVNNKECYVTSPn----------EDFLVFADEI--EEDIA 220 Leptosp...
Q8F4Q5               159 KSKYdf-lKVDVFGTIGDK---FDLVKK----TRKILYISNTQKEQSYAAYNq----------EDFIDYAAELgdEEDVH 220 Leptosp...
Q8F7M4               260 NFFRELQKKEIRefviSYIVLPIRLFND------VVGYIRVYTSAMdrfSITPFQVGYLIEL 315 Leptospira interrogans
Q8F8I0               219 SCIQEYKDQQII----SELIVPIVYINHsee-qiPIGYFSIQSKEQ---SFTEKDIQEFQTL 272 Leptospira interrogans
Q8F713               221 SLMRKYKDEKIV----SEIIYPIIYINHsrq-siPLGYIWVRNKEK---TLGNNTIEKLAEL 274 Leptospira interrogans
WP_012389661         213 KLAFAARDKKIK----SELILPILYKNElee-iiPIGYYWLQTKDK---LISDDD---LKFY 263 Leptospira biflexa
Q8F9Y2               224 ERLRFFKSSKTR----SLLIYPILFKSGgetqifAMGVI--ESSEG---PISDQVVPLYKEM 276 Leptospira interrogans
instpast:LEPBI_I0868 261 EFFESMRKHESRnfyvSYIITPIRLYED------VVGYIKVFSTAMerfTISQNQAVYIFEL 316 Leptospira biflexa serova...
instpast:LEPBI_I1271 221 KEINNRRNLKIK----SELILPILYLNDeee-siPIGYIHMQSKSE---NFDLLKAMEMKTL 274 Leptospira biflexa serova...
Q8F4Q5               221 KRIIEYANQKIK----SELIVPVIYLSHeeq-aiPIGFVHAQNRSR---EIDILEVMEIKTL 274 Leptospira interrogans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap