Conserved Protein Domain Family
DUF1574

?
pfam07611: DUF1574 
Protein of unknown function (DUF1574)
A family of hypothetical proteins in Leptospira interrogans.
Statistics
?
PSSM-Id: 369442
View PSSM: pfam07611
Aligned: 9 rows
Threshold Bit Score: 257.309
Threshold Setting Gi: 390609680
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012387567           6 NRYLFVPFLVVFLTFCLDKLLILENI--HTYFSKSLSDINYIQKNELYEDLK-------EYLSLK-DRDKVLVYFGNSRG 75  Leptosp...
jgi:Turpa_0170        12 KRWLYYPLILLALLFAADKLLLLTGKpsAGAVEGSGIQLTETARIRLDNEASfvakkrgTLTGCG-SACRTVLVFGSSRS 90  Turneri...
instpast:LEPBI_I1817   5 fPIVLYPFLLVLVLFLFDKIFFLPIIveNTYSWKKIERKFYELKEDLFEVML-------DVSKKD-PSKQIGLILGSSRS 76  Leptosp...
Q8EXJ7                16 KKLLTVPLLFFIFALSLDRLLSSQLV--RPYTEAGAEYYFYEMKDRVLSALIk------EKSISK-ENQKTLIFFGTSHM 86  Leptosp...
instpast:LEPBI_I1464   4 KPFLFYPVVLFLFIFLVDKIFLLPIF--HDEFLQAGNSVFYFQRKVLKERLL--------RDPDL-KDKKLALVFGDSRS 72  Leptosp...
Q8F3W0                 4 KIYIYYPILFLGFVFCLDKVFTLEYF--QKNFIQAGNTVYYTQRKSLFEKLI--------RDKDL-EVKSLALAFGDSRA 72  Leptosp...
Q8F3Z4                 4 NRFLLIPFVIFLISFGIDKLISSTIF--EPYYSLSLSDLNFKHKEFLFEELK-------DYLKKK-DRKKVLVYFGNSRA 73  Leptosp...
Q8EY13                 4 KPFLWYPVLLFFAIFLFDKLFFLDQV--RDYVKQEFTYIYYDVKKELLKEIVfkygpdgEYTRNPeKKKKLMILMGSSRM 81  Leptosp...
WP_012476590           4 ARFLFYPVFLLTFLFLVDSIFRIPYI--QTLAKIDLTAVNYEAKSDFLQKLIee----kPGVNTP-KTKKIMLVLGSSRL 76  Leptosp...
WP_012387567          76 LLF-------D-NEYIHKKYPGWVMFN----FSVPGGKPDYVLQWMEEFEKD-GVKPDFFLFDHSVEMF------NSAAS 136 Leptosp...
jgi:Turpa_0170        91 ERFnllkqeaSiTEFLAAKERDQILETqflvYAQVGAQMVVYYHAVDRLWRQ-NLIPDAIVFELGPELLelehrnNHGKS 169 Turneri...
instpast:LEPBI_I1817  77 GEF-------D-SEMVEEFFPNTNSFN----FAAPFGPPSFQAYWLERVLKT-KLPIRYVLIEVDPLLF------SKSSI 137 Leptosp...
Q8EXJ7                87 GEF-------S-LDVMRKKRSDLIVYN----FSAPSAPFSYHNYNLEKILSS-GIKPDYAVLEFYPDSM------TDFCN 147 Leptosp...
instpast:LEPBI_I1464  73 YPF-------SeLGIPEPHKKDWSLYN----FSSPQGIPMNSFIQFQEILES-GVTPNFVILSLSPEAF------DDSKG 134 Leptosp...
Q8F3W0                73 YPY-------SsMGIEQKLQKDWVLYN----FSGPQAVPAYGLYWFEKIIKQ-GLKPKLVFYVVSPEGF------DDTKG 134 Leptosp...
Q8F3Z4                74 LLF-------R-NDYIEKKYPDWFLFN----FSVPGGSPDYYLYWLERFQSD-GVKPDFILMDESIEIF------NSSSI 134 Leptosp...
Q8EY13                82 LYF-------Q-NSDLLAFYPDWDIYN----LSSAVTTPAYYLYFLEKLIKNgGVHPDLIVIETDPFQF------NKNST 143 Leptosp...
WP_012476590          77 LYF-------D-YDELVSFYPDWEIYN----LSSAVTTPAYYDFQLTKILDV-GIKPDLVIMETDPNQF------NQNS- 136 Leptosp...
WP_012387567         137 LKvdeTLTNGLNVSFVlKHFSLFSTE--------------DIS-TLIAKRMFRAYQYRPKLEVIIARAKNKDsflypyrd 201 Leptosp...
jgi:Turpa_0170       170 EF---IFSDEYDYDYY-RLLEKFGKK--------------SVSeEARARLIFAGYALKPRPELLISDYRARP-------- 223 Turneri...
instpast:LEPBI_I1817 138 DY---SLNGSYDNLYIlNHIDFFRSKtvdpwstkttgfsvDEAeVYFLKKLFALYKYPLDPSAIKANNKEIEigffpgls 214 Leptosp...
Q8EXJ7               148 RY---PLRYSYDLSYFlRYANWFSTN--------------DWD-TFLRSRVFRTTVFPPRFKEAMGRIKDPnsketilav 209 Leptosp...
instpast:LEPBI_I1464 135 FIlspFLRMGCDKNCIeTVWEDVPSK--------------EKW-YYFLDHVFAIRSVEFNLSLFSSRLKQGKlreyksay 199 Leptosp...
Q8F3W0               135 IFynpFLKYGADDDFLlKYMDQISFE--------------DRK-KLFLDRLFAVRRINPDLKLFIKRFQEKKlseydpaf 199 Leptosp...
Q8F3Z4               135 LTldeVLFYGLSPIFVfRHLDRYSYS--------------DLT-GYIVKKLFHTAKNRPRWSVIRARAKDGGilakgysk 199 Leptosp...
Q8EY13               144 TFkkaNLANSFDPIFIlKYAWTFGKE--------------NVN-YYFANFLFGVSYNKPYIGNVIKRFKNENsamgellk 208 Leptosp...
WP_012476590         137 VFkssNLTYSFDLGYVlSNLSLFGKD--------------HVS-FYLGRKLFAVGTYKPYLDQMWKNYKNPYlenvlgmh 201 Leptosp...
WP_012387567         202 lrnnlma---------nlksgkgsamtpgthQAVLPPELLKKSAYGDFHSYLVP------------------------FR 248 Leptosp...
jgi:Turpa_0170       224 -------------------------------QNERPQYSILEKYIRGYKDYLDSdltgklrderigqflsmyegnykiFA 272 Turneri...
instpast:LEPBI_I1817 215 sgitgkehkrgyidkiklvnrakfgalpneiKFANMDLFLERDAEAMYNQYLRG------------------------SS 270 Leptosp...
Q8EXJ7               210 rnllm------------tesdkfnggipnvlLTNTPPEKLEEEAIKYYNETYRY------------------------IS 253 Leptosp...
instpast:LEPBI_I1464 200 nqeyq-------------linftkgeylmygVHENPIEKIKNDTVRIGNLYMRS------------------------FV 242 Leptosp...
Q8F3W0               200 ntdym-------------vlnlkrgeqfaytTFVNDPDRLEKDAVRIRNLYLST------------------------FI 242 Leptosp...
Q8F3Z4               200 lrseiwe---------nlkkqrgsatsdsspRVVLPAELLKKRSNTDFKSYLSN------------------------FT 246 Leptosp...
Q8EY13               209 tmtiat-----------lksdkgnaispagaYVEKDFGKIQESARKTIGWIYPS------------------------YA 253 Leptosp...
WP_012476590         202 kstydy-----------ilthngnglspidnYMEKDSNALLQTSHRTLDWLFAS------------------------YQ 246 Leptosp...
WP_012387567         249 FSENILSFTDQSLDLAKKLNVPSAVIWVRLSLPYMDHIRhlkvsvgenkegtvYDDWYPRMVGYHKE--NGIPFWNMND- 325 Leptosp...
jgi:Turpa_0170       273 VDPLMDESLRRIVKLARDKNVPMLLYKPFVHEELNRVLD--------------KTPYAPAVEKYAIDlpGGSVKFHFAK- 337 Turneri...
instpast:LEPBI_I1817 271 LSPTQIFFFKKMLHLLEGTGIPVIIYFPAVSEPLRRKMQtdgllerfnleirnQVSLVSKVP----N--SKFYVIDPNV- 343 Leptosp...
Q8EXJ7               254 LSLIQKKFLFQFLKTAEKNGIKVILWSPLLYEGLETRVKsa----------efYSIWENIRKEILEF--KNVVSLDMNEf 321 Leptosp...
instpast:LEPBI_I1464 243 LGKSQLPYVEAFLKLTKEKNIKTLVIWPKVFPGYYSYYEkf----------qvKEVWWNPIEVMAKQ--YGASSLNWNQ- 309 Leptosp...
Q8F3W0               243 LGTTQFFFVEQFLKLAKENDVKVYLIWPKVYETYRKRYYel----------emEKSWWPKIENLAKR--YSAVPVDLNT- 309 Leptosp...
Q8F3Z4               247 FNPKMLANQADAIQIVKQMGISYAMIWVRVARPYFELYKtkkvstgnlnektpYEIMIPILQKLHES--TGTSFWNMNE- 323 Leptosp...
Q8EY13               254 PSEMQYEFYKKIFILQREENLKILFVRPGVSPPMEKVLDel----------kiPETWSQKIKPIHDD--WKIPLIDMSK- 320 Leptosp...
WP_012476590         247 RSPMQFGFYEKILTRLQNENIKSVIVWPMSSPDFENLLEke----------slVKTWETEIDTITKN--HNFSILKLKH- 313 Leptosp...
WP_012387567         326 DPTYTCNEFSDAGHMSPSCYDEYTDYIFKNL 356 Leptospira biflexa
jgi:Turpa_0170       338 QDDYKCKFWSDASHYSTRCTPEIMHHLLRQL 368 Turneriella parva DSM 21527
instpast:LEPBI_I1817 344 DPNWKCKDFVDSLHLSGACFPNLLPILFPKY 374 Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
Q8EXJ7               322 RAQVKCKKYIDPHHLSGGCYLEPTEILVDRL 352 Leptospira interrogans
instpast:LEPBI_I1464 310 --PNTCDLFNDASHQSALCFVDQMKeiwiny 338 Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
Q8F3W0               310 --QTSCDLFYDASHQSIMCFLESMKLMIDDY 338 Leptospira interrogans
Q8F3Z4               324 DKEYHCDDFSDPGHMSPNCFNDYADFIFKRL 354 Leptospira interrogans
Q8EY13               321 DPYYACNSYADSGHISLDCYRPFIRFILLHY 351 Leptospira interrogans
WP_012476590         314 DPSYTCNAFADGGHVAKDCYRGLMRSILLEY 344 Leptospira biflexa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap