Conserved Protein Domain Family
DUF1569

?
pfam07606: DUF1569 
Protein of unknown function (DUF1569)
A family of hypothetical proteins identified in Rhodopirellula baltica.
Statistics
?
PSSM-Id: 369441
View PSSM: pfam07606
Aligned: 9 rows
Threshold Bit Score: 170.681
Threshold Setting Gi: 500152012
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q083J2         29 GNDPEQLTITallAKLNQLTMLSTEQLAHLshGEWNSAEVFAHCAQSVEFSMSGFPEHKSALFK--QTVGALAFTAFATK 106 Shewanella fri...
Q47YF7         30 ETNKFDLKIS---SALNKLELLSDKNLVQT--GKWELYKIFTHCAQSVEYSMSKFPEHKSSFFK--NTIGKLAFSLFSSK 102 Colwellia psyc...
jgi:Pmen_3279  32 AA-------VsleGALAVLGTLQGMTLRSL--KGWSPSEVFNHCAQSIEYSMEGYPALKPAWFR--HSLGPAAFAVFSAR 100 Pseudomonas me...
WP_011828015   43 WA-----------EARNAVFALAQPGSRWRsnGHWSLSQALQHLAQSVEGSLAGYPRLKPAWFT--HTVGAAAHAVFEAR 109 Methylibium pe...
Q28UV1          2 MN-------TaldTAFHRLDTLDLSAIQST--GDWDLGRTFSHLAQGVEFSMTGYPQEKPRLFQ--MTAGKLAFTVFKLR 70  Jannaschia sp....
Q7UEB2          1 MEQLRELHFDdlnAAVREARSLLQSGYNRN--GNWSLGQICRHLVLVQDPSVDGYPKWMS-LFAflRPVMRRILLPKVLS 77  Pirellula sp.
Q7UJY4          1 MSDLRSLQFEnldDAVLEAQSLLRTGYHPQ--GNWSLGQICRHLTLVQNPSVDGYPAWMS-LFAflRPAMRRFLLPKLRR 77  Pirellula sp.
Q7UH50         56 ATRRMDLRYPdlgAACTDIARLREGGYELV--GTWSLAQILDHLNLSMQMTIDGADFTFPALM---RPVMKWMFMPTMRK 130 Pirellula sp.
Q7UJR0         85 KISKRSLDFHsgdEVIAEIKRLQEGGYVQT--KNWNLTQICEHLDLIMTGGMEGFGFRMPRILR--ATVLKWIIGRILRQ 160 Pirellula sp.
Q083J2        107 GAMSH--NLAEPIPAAPKLDRNLDVNLALARLIQSLTDFQQYQAELAPH-FAYGELNKADYELAHVLHFYNHQQSFTKM 182 Shewanella frig...
Q47YF7        103 GKMTH--SLSEPIPGSPLIDSTLDTTEALNHLKKSLTDFDNYKGELAPH-FAYGELTKSDYEIAHVMHLYNHLQEVKSI 178 Colwellia psych...
jgi:Pmen_3279 101 GAMRH--PLDEAIPGAAPLLEPASQAQALERLQVAFERFAAYGGELQPH-FAYGALDHGEYAQAHVLHLYNHLSLIRPA 176 Pseudomonas men...
WP_011828015  110 GRMTH--PLDEPLPGAAPLDAALPPDAAALRLLRAMDAFEAHDGTLAPH-FAYGVLDKPAYARAHQMHLAAHWQQFEET 185 Methylibium pet...
Q28UV1         71 GRMSH--GLDEPIPGEVIGEVSADD--GLHRLWSSLEQFRDFNGALQPH-FAFGALGKDQFAMAHLMHIENHLEEVRPT 144 Jannaschia sp. ...
Q7UEB2         78 GDS----PRGIRTASMFVPPADLDDAREVEAFSASVTRFYAHLGDYAPH-PAFGRLPRERIEQIHSAHAAHHLRFLAPR 151 Pirellula sp.
Q7UJY4         78 PDS----PRGIRTSSMFVPPEDIDDAEEVDTFARSVDRFRAHSGEYAPH-PAFGRMSRSEIEEIHTWHAAHHLRFLTPN 151 Pirellula sp.
Q7UH50        131 GKPS---KLRGKAPEQLQPAMDLDEDACAKRFYSLAETLMDPSTPFVSHyPMLGRLTREQWLLMQQWHAAHHLSFVVPN 206 Pirellula sp.
Q7UJR0        161 RKMSSapTLDRLKPKS---PDGPDDPSVIDHCIETIHRAKAFDGSMEDY-PFVDNMTPDMWRQFMWLHAAHHLGFLVPK 235 Pirellula sp.
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap