Conserved Protein Domain Family
Peptidase_M26_C

?
pfam07580: Peptidase_M26_C 
M26 IgA1-specific Metallo-endopeptidase C-terminal region
These peptidases, which cleave mammalian IgA, are found in Gram-positive bacteria. Often found associated with pfam00746, they may be attached to the cell wall.
Statistics
?
PSSM-Id: 400116
View PSSM: pfam07580
Aligned: 4 rows
Threshold Bit Score: 1026.72
Threshold Setting Gi: 81667566
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q59947        1203 NLAEYNLGNTGLLYTPNQFLYDRDSIVKEVLPELQKLDYQS--DAIRKTLG----Isp---evKLTELYLEDQFSKTKQN 1273 Streptococcu...
bgi:05SSU1022 1162 HVVEYTISGTDLIYTPESFLNDRSALVNDLVSSLSSVVLDS--DAMKAVINypttLnadtqtgTAKDFYFGESYDQVMTN 1239 Streptococcu...
Q8DQN5        1136 QVKEYNVDDLGVVYTPNMVDKNRDSLITKVKEKLSSVALDS--AEVKSITN------------NPASLYLEESFAEVRET 1201 Streptococcu...
Q74I86         130 NISDATISDQQPVQTEKKVDAD---LVKSVTDSLKQVKYDAfdGDPKQVLRnwnhI-------QLTSSSLVDSFNEVYNQ 199  Lactobacillu...
Q59947        1274 LGDSLKKLLSADa-gLASDNSVtRGYLVDKIKNNKEALLLGLTYLERWYNFNYGQVNVKDLVMYHPDFFGKgNTSPLDTL 1352 Streptococcu...
bgi:05SSU1022 1240 LESNVRKILVAS---LNGQGQAsEDYIKEKIINNKAAFVLGLTYLNRWYDINFGEMNTKDLTIFEPDFFGNdAASALDMI 1316 Streptococcu...
Q8DQN5        1202 LDKLVKSLLENEdhqLNSDEVA-EKALLKKVEDNKAKIILALTYLNRYYGIDYDGLNFKHLMMFKPDFYGK-TPSILDFL 1279 Streptococcu...
Q74I86         200 LPTLVPQLLEHTd-nIDTANQ--------RVSDNAGAIMVGMSYINRWYNVSYGDKQLLPVMMFDPKAFGS-NLDSIDWL 269  Lactobacillu...
Q59947        1353 IELGKSGFNNLLAKNNVDTYGISLAS-QHGATDLFSTLEHYRKVFLPNTSNNDWFKSETK-AYIVEEKSTIEEVKTKQGL 1430 Streptococcu...
bgi:05SSU1022 1317 LAIGNGGYDVLRAHNNVTTFASIIGK-QNNQTKLFDMLEDYRQLFLPEMTNNEWFKQTTK-AYVVEGKSLIPEVAAKQET 1394 Streptococcu...
Q8DQN5        1280 IRIG-SAEKNLKGDRSLEAYREVIGG-TIGKGELNGLLGYNMRLFTKYTDLNDWFIHAAKnVYVSEPETTTEDFKDKRHR 1357 Streptococcu...
Q74I86         270 SKIGDWSTDELAPSNTVTAFNNKLAPlLNTQSDLVTFLGDLRKKWTPDLSDEEWFRSNTG-VHIVEIPS--------KEA 340  Lactobacillu...
Q59947        1431 AGt--kYSIGVYDRITSA-----TWKYRNMVLPLLTLPERSVFVISTMSSLGFGAYDRYRs----sDHKAGKALNDFVEE 1499 Streptococcu...
bgi:05SSU1022 1395 TDtyskYNVGAYSKIVNDtvsnpTWKYNHMLLPLLTLPQENIFIITNMNTIAIGSYEHYV------DDYSTVENRDKVRQ 1468 Streptococcu...
Q8DQN5        1358 ----------IYDGLNND-------VHGRMILPLLNLKKAHIFVISTYNTIAFSSFEKYG--------KNTEEERNAYKA 1412 Streptococcu...
Q74I86         341 PD----LNLNIYHRLST------NKDLQEYILPLLNVKNDDMYVVSALGMMIFGSYEPYIdvkyhkDPVVYQEKVQAVHK 410  Lactobacillu...
Q59947        1500 NARETAKRQRDHYDYWYRILDEQSREKLYRT-----ILLYDAY-KFGDDTTSGK----ATAEAKFDssnpAMKNFFGPVG 1569 Streptococcu...
bgi:05SSU1022 1469 MVDLAAERQRDNADFWYKILDETNRDKLFRS-----VLNNEGYvMYGKDGTKSY----RNLTADVD----AIQDFYGPIN 1535 Streptococcu...
Q8DQN5        1413 EIDRVAKAQQRYLDFWSRLALPKVRNQLLKSqnsvpTPVWDNQ------VYVGLgganRMGYGDGGrvvtPVRELFGPTD 1486 Streptococcu...
Q74I86         411 ELTRLSTAWRDHFDFWYRMANEAGKKRLSNAn----IQIWDSY-NAIDSSKKGG----RRWLNKRDtdipAVAEFFGPLG 481  Lactobacillu...
Q59947        1570 NKVVHNQ--HGAYATGD---------GVYYMSYRMLDKDGAI-TYTHEMTHDSDQDIYLGGYGRRNGLGPEFFAKGLLQA 1637 Streptococcu...
bgi:05SSU1022 1536 KWYREHPsiKTAFADGS---------ETYYITYDMLTDYGTA-LYTHEMVHNQDGDIYLKGYGRRIGQGMEVYAQGLLQN 1605 Streptococcu...
Q8DQN5        1487 RWHQIN---WNMGAMAKiyerpwkddQVYFMVTNMMEPFGIS-AFTHETTHVNDRMAYYGGDWHREGTDLEAFAQGMLQT 1562 Streptococcu...
Q74I86         482 KMYEAAG--LSADAVGN---------AVRYYVAQVVNNFGGIgILSHEMTHNFDNSIYLDGFQHRPGTGVETYATGLLES 550  Lactobacillu...
Q59947        1638 PDQPS----DATITINSIlkHSKSDStegsRLQVLDPtERFQNAADLQNYVHNMFDLIYMMEYLEGQSIVnKLSVYqKMA 1713 Streptococcu...
bgi:05SSU1022 1606 VFNVT----EMNLGFNAV--YNSDDAn---RVHVGDPvARFNSEADFNEYYHNQFDVLYLLDYLEGTNIL-AQSDAnKKA 1675 Streptococcu...
Q8DQN5        1563 PDKSTtngeYGALGINMAyeRKNDGE----QLYNYDP-EKLDSREKIDSYMKNYNESMMMLDYLEASAVIrQNLSD-NSK 1636 Streptococcu...
Q74I86         551 PWDRT----FANYGLNTAltFYADNN----RTTNKSP-SRFQTRKDLQDYMHGVFDVTYLLDYAEAQAMVgKSAKD-KQL 620  Lactobacillu...
Q59947        1714 ALRKIENKYVKDpaDG---NEVYATNVVKELTEAE-ARNLNSFESLIDHNILSAREY------QSGDYERNGYYTIKLFA 1783 Streptococcu...
bgi:05SSU1022 1676 WLRKIENYYVQN--NG---VDTHAGNSARALTDAE-VASLKSFNDLIDQSIIVQRQYvnnptnTSKKWDRNSYVSVPMFA 1749 Streptococcu...
Q8DQN5        1637 WFKKMDKEWRTNadRNrliGEPHQWDKLRDLTEEEkKLPIDSIDKLVENNFVTLHGMpkngryRTEGFD-SSYQPVNMMA 1715 Streptococcu...
Q74I86         621 MYSQISY------------DPAKKADVVSGPISTEiADKLMTIDDFIDNNIIASRGY------QAGSYGTNSYQTISMYA 682  Lactobacillu...
Q59947        1784 PIYSALSSEKGTPGDLMGRRIAYELLAAKGFKDGMVPYISNQYEEDAKQQGqtinl--ygkeRGLVTDELVLKKVFDGKY 1861 Streptococcu...
bgi:05SSU1022 1750 ANFSALSNSNGSPGDIMFRRMAFELIAAKGYTDGFVPYASGQLSDLAMEKGsiiydtwnkknTGLITDDHVLEYVFQGQY 1829 Streptococcu...
Q8DQN5        1716 GVFGG-NTSKSTVGSISFKHNAFRMWGYYGYENGFIPYVSNKLKGAANKEN-----------KGLLGDDFIIKKVSKNQF 1783 Streptococcu...
Q74I86         683 PDYAAVQSSTSVSGGITFKKTAFELLAAKGWSNGFISYITNKYAKDAKND------------KKSLSDTYALAKIFNGEY 750  Lactobacillu...
Q59947        1862 KT-WAEFKTAMYQERVDQ--FGNLKQVTFKDPTKpwpsygTKTINNVDELQALMDQAVLKDAEGPRWSNYDpeidSAVHK 1938 Streptococcu...
bgi:05SSU1022 1830 TS-WAEFKKAMFTERLEKaaTGQLKPFTMQYELGvadstkEVTITSFEQLQNLMKEAMEADIQANSLKLDN----SRVHA 1904 Streptococcu...
Q8DQN5        1784 QN-LEEWKKHWYHEVYDKa-QKGFVEIEVD----------GVKISTYAQLQSLFEEAVSKDLAGMDDKNIKnh-yQYTEN 1850 Streptococcu...
Q74I86         751 DNdYAIFKKAMFKERIDK--RQDFKPITITLDKK------SIQLNSWDDLQNLMQTTVDQELAVRAQGKKS----SLIND 818  Lactobacillu...
Q59947        1939 LKRAIFKAYLDQTNDFRSSIF 1959 Streptococcus pneumoniae R6
bgi:05SSU1022 1905 LKVKVYQPLMNSTNDFKTSIF 1925 Streptococcus suis 05ZYH33
Q8DQN5        1851 LKWKIYKQLLKNTDGFSSDLF 1871 Streptococcus pneumoniae R6
Q74I86         819 LKAAILTAELKQTDDFRSSIF 839  Lactobacillus johnsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap