6HQA


Conserved Protein Domain Family
TAF6_C

?
pfam07571: TAF6_C 
Click on image for an interactive view with Cn3D
TAF6 C-terminal HEAT repeat domain
TAF6_C is the C-terminal domain of the TAF6 subunit of the general transcription factor TFIID. The crystal structure reveals the presence of five conserved HEAT repeats. This region is necessary for the complexing together of the subunits TAF5, TAF6 and TAF9.
Statistics
?
PSSM-Id: 400110
View PSSM: pfam07571
Aligned: 116 rows
Threshold Bit Score: 58.6417
Threshold Setting Gi: 74685345
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HQA_E       312 ILTLLLAKKI-----GNV--------------------------DDELQKqqqLALRELSASLLERVIEDFGSSYSTLKP 360  Komagataella p...
XP_001991913 541 VVTCQVANKL----------------------------------STAKDKy-hWQLREYACEIMGQLINKFANSTNRMVP 585  Drosophila gri...
XP_002054619 260 VLSCTVSRQV-----CAF--------------------------PAVQNH---WALREYAANIMAELVKTFDSDDNSIMP 305  Drosophila vir...
XP_001999400 262 VLSCAVSRQI-----CAF--------------------------PTVQNH---CAAREYATNIMADFIRAYGYPGNDILP 307  Drosophila moj...
EAY13138     273 SQTVVVTNNLin----------------------------------------dECIRQTAGDIIIALIKRASSEYPGIRT 312  Trichomonas va...
EAY01705     264 igiCLATKEV-----------------------------------ITKCAredCYIRDIGANIVSLITSRCLNSFPNADI 308  Trichomonas va...
EAY13936     250 cmsgLIGTDV-----------------------------------GSNETdddSNVRRCASQLLNVLHSKCKNAYPAMTK 294  Trichomonas va...
Q965Y0       361 liSCVVSKNMvpildVSRvglkakpttvtplgatppeltaddreRIIRDLefeFKLREASGKLLAELSSQYQNL--NLNV 438  Caenorhabditis...
XP_002634528 364 lISCVVSKNMvplvdPSRgahgssksktvt--agtpeltsedheRIIRDMefeFRLREAAGKLLAELSNQYESQ--NLSV 439  Caenorhabditis...
XP_003089302 368 liSCVVSKSMvpivdPARaglktktstvnv---gtpeltaedreRIIRDLefeFKLRESTGKLLAELASIYKDQ--NLRV 442  Caenorhabditis...
6HQA_E       361 RITRTLLRAFVSVnNTTPGTQYGALLGLRGLGSEVIRIVVLGNVI 405  Komagataella phaffii GS115
XP_001991913 586 RLMNVYKSGL--E-KSSLTTIYGSLIGLQALGDTAIYGCVIPKIR 627  Drosophila grimshawi
XP_002054619 306 RVINIYKAGL--Q-SSSLTTIYGSLIGLSKMGKYAVRGCVIPQIR 347  Drosophila virilis
XP_001999400 308 RVISVYKNGL--K-SSILMTIYGSLVGLSKMGRYAIRDCVIPEIR 349  Drosophila mojavensis
EAY13138     313 EIFNQLVGVSFNP-ETNYPALYGALYTLLNLDDDAFRTVI-PHAK 355  Trichomonas vaginalis G3
EAY01705     309 ECFNYFNDIIFSE-NNSIHVLYGALSGIFSLGNDYIERIL-PHLP 351  Trichomonas vaginalis G3
EAY13936     295 AIYNSLISVLFNE-TTSIAAHIGAVYGLEVLGIESCERVI-PHLa 337  Trichomonas vaginalis G3
Q965Y0       439 RIIQTLRGVLSG--NQDPAAIYGVLCTLFAFGNLTINSVVLPKMH 481  Caenorhabditis elegans
XP_002634528 440 RIIQMLRKVLAG--QKDPVAIYGVLCTFFAFGNLTINTVVLPKMH 482  Caenorhabditis briggsae
XP_003089302 443 RIIQMLRKVLTG--NKDPVAIYGVLCTFFAFGSLTINTVVLPRMH 485  Caenorhabditis remanei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap