4KY9,5JHO


Conserved Protein Domain Family
Band_3_cyto

?
pfam07565: Band_3_cyto 
Click on image for an interactive view with Cn3D
Band 3 cytoplasmic domain
This family contains the cytoplasmic domain of the Band 3 anion exchange proteins that exchange Cl-/HCO3-. Band 3 constitutes the most abundant polypeptide in the red blood cell membrane, comprising 25% of the total membrane protein. The cytoplasmic domain of band 3 functions primarily as an anchoring site for other membrane-associated proteins. Included among the protein ligands of cdb3 are ankyrin, protein 4.2, protein 4.1, glyceraldehyde-3-phosphate dehydrogenase (GAPDH), phosphofructokinase, aldolase, hemoglobin, hemichromes, and the protein tyrosine kinase (p72syk).
Statistics
?
PSSM-Id: 400106
View PSSM: pfam07565
Aligned: 16 rows
Threshold Bit Score: 346.201
Threshold Setting Gi: 114788
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KY9_P      36 ENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAG 115  human
Q29N79      99 DVEEGGNRWSKPHVATLSLHSLFELRRLLVNGTVMLDMEAPNLEVMADLVCDQMVSAGTLPPGVKDKVKDALLRRHRHQH 178  Drosophila pseud...
Q17LT4     264 DVEEGADRWGRPHVASLSFHSLLNLRRCLETGVVLMDLEEKDLPSVAYRIVEQMVIDELIHEDDKPTIMRALLLRHRHVN 343  yellow fever mos...
O18917     351 DVEEETERWGKPHVASLSFRSLLELRRTIAHGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRTLLLKHCHPN 430  rabbit
P04920     352 DVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPS 431  human
P04919     100 ENLREDGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQDREELLRALLLKRSHAE 179  house mouse
Q2Z1P9     102 enlgEDGAWGRPHLSYLNFWSLLDLQRAFAKGSVLLDLSETSLAGVAEKLLDRFIYDGLIRPQYREDLLWVLLLKHSHAR 181  horse
Q9TUQ0      21 ENLGKDGIWGRPHLPYLNFWSLLELQKAFAKGTVLLDLPGKSLAEVANQLLDRFTFEGQIQPDDQDNLLRVLLLKHSHAS 100  cattle
CAG09337   149 DVEDGGERWSKPYVATLSLHSLFELRSCIFNGTVLLDMRANTIEEIADMVLDHREIYSPLGNEVRKKVRATLLKQHHHQN 228  spotted green pu...
XP_308789   85 NLEEEADRWGRPHVAALSFHSLLNLRHCLETGVVLMSLEANDLSIVAHRVVEQMVARELIHEDDKPVIARALLLRHRHVN 164  Anopheles gambia...
4KY9_P     116 ElEALGGVKPAVLTRSG-----------DPSQPLLPQHSSLETQLFCEQGDGG-----------------TEGHSPSGIL 167  human
Q29N79     179 E-YAKKTRLPIIRSLADmrnhssskkkkSNSKNLRPTQNLPVITEDMVKSPSSqsmarps---sgtelndQQHKGNTHFM 254  Drosophila pseud...
Q17LT4     344 EhSHGGFHFGPKRKYSSyssl----qsvDDKKPRIVPSSEINGH--GHGETKInmheety---tssqediKMRTQKESIL 414  yellow fever mos...
O18917     431 D-DKDCGSFPRNPSSSSvnsvl--gnhhATPSHGPDGAVPTMADDLGEPAPLWphdpdakerplhmpggdGHRGKSLKLL 507  rabbit
P04920     432 DeKDFS--FPRNISAGSlgsll-ghhhgQGAESDPHVTEPLMGGVPETRLEvererelpp-pappagitrSKSKHELKLL 507  human
P04919     180 DlGNLEGVKPAVLTRSG-----------GASEPLLPHQPSLETQLYCGQAEGG-----------------SEGPSTSGTL 231  house mouse
Q2Z1P9     182 DlKELDGVKPTVLTPSG-----------GTLQPLLPEHPSLETQLFCAQGEGD-----------------TEESSPSGIL 233  horse
Q9TUQ0     101 DmEALGGVKPVVVTHSG-----------DPSEPLLPQHPSLETELFCEQGEGS-----------------TRGHAPE-IL 151  cattle
CAG09337   229 Q-KKLANRLPIVRSIADmgrra-selhlDKSDQMTSSQSQLAGPEGKAEASKEns-------------fvDFSKIDLHFM 293  spotted green pu...
XP_308789  165 EnTHGGIFYGSRRRLSSftsir--svknDSRKPRIIPVVEINGH-GGQSEMRLnindesy-------tssqediKMCTIL 234  Anopheles gambia...
4KY9_P     168 EKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAE----LEAV-ELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSER 242  human
Q29N79     255 RKIPPGAEASNILVGEVDFLERTLSCFIRLSQAAL----MGDLtEVPVPTRFIFILLGPPGSQSNFHEIGRAMATLMSDE 330  Drosophila pseud...
Q17LT4     415 KRIPEGAEATTVLVGSVDFLEQPTIAFVRLAEGIP----MPSItEVPIPVRFLFILLGPKTAELDYHEVGRSIATLMSNE 490  yellow fever mos...
O18917     508 EKIPEDAEATVVLVGCVPFLEQPAAAFVRLSEAVL----LESVlEVPVPVRFLFVMLGPSHISTDYHELGRSIATLMSDK 583  rabbit
P04920     508 EKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVE----LDAVlEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDK 583  human
P04919     232 -KIPPDSETTLVLVGRANFLEKPVLGFVRLKEAVP----LEDLv-LPEPVGFLLVLLGPEAPHVDYTQLGRAAATLMTER 305  house mouse
Q2Z1P9     234 EKISPDSEAALVLVGRISFLEKPVLGFVRLREAVE----LEATvEPSVPVRFLLVLLGPEAPHTDYTQLGRAAATLMSER 309  horse
Q9TUQ0     152 GKSPQDWEATLVLVGCARFLKRPVLGFVRLKEPMEpepkPEGSeEPAVPVRFLIVLLGPEGPNINYTQLGRAAATLMSER 231  cattle
CAG09337   294 KKIPVGAEACNVLVGELDFLNRPVVAFVRLSPAVL----LSGLaEVPIATRFLFILLGPTGRGPQYHEIGRSMATLMTDE 369  spotted green pu...
XP_308789  235 KRIPEGAEATTVLVGAVDFLEQPTIAFVRLAEGIP----MPSItEVPIPVRFLFLLLGPQKTDLDYHEVGRSIATLMSNE 310  Anopheles gambia...
4KY9_P     243 VFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSE 279  human
Q29N79     331 IFHEVAYRARKREHLLAGVDEFLDAVTVLPPGEWDPT 367  Drosophila pseudoobscura
Q17LT4     491 HFHDIAYRADDRKDLLSAINEFLDDSIVLPPGKWERQ 527  yellow fever mosquito
O18917     584 LFHEAAYQADDRQDLLGAISEFLDGSIVIPPSEVEGR 620  rabbit
P04920     584 QFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGE 620  human
P04919     306 VFRITASMAHNREELLRSLESFLDCSLVLPPTDAPSE 342  house mouse
Q2Z1P9     310 VFLNEANTAQSKEELVRSLEGFLDCSLVLPPLDAPSk 346  horse
Q9TUQ0     232 VFWNDAYLAQSKETLVQSLEGFLDCSLVLPPLDAPSE 268  cattle
CAG09337   370 VFHDVAYKAKDRNDLIAGIDEFLDQVTVLPPGEWDPs 406  spotted green pufferfish
XP_308789  311 HFHDIAYTADDREELLSAIDDFLEDSIVLPPSKWERQ 347  Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap