2KY9


Conserved Protein Domain Family
DUF1541

?
pfam07563: DUF1541 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1541)
This family consists of several hypothetical bacterial and occurs as a tandem repeat.
Statistics
?
PSSM-Id: 400104
View PSSM: pfam07563
Aligned: 46 rows
Threshold Bit Score: 68.863
Threshold Setting Gi: 81347316
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KY9_A                   3 VGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQ 54  Bacillus subtilis
jgi:Exig_0513           66 DGANVVLSSDHMKGMDGAEATVVDSFDTTVYAVSFTPTNGGKKVSNHKWVIQ 117 Exiguobacterium sibiricum 255-15
WP_009792308            68 VGSTVILETGHMDGMEGAEAEVSGAYDTTVYAVSYTPTTGGEKVENHKWIIQ 119 Bacillus
PRJNA212797:N288_24750  82 VGSKVIIEEGHMPGMQGAEATVAAVYDTTVYTVSYDPVTGGDRIENHKWVVH 133 Bacillus infantis NRRL B-14911
Q5WCN8                  68 VGSKATMEANHMPGMKGTEATIVGAYTTTAYAVSYTPTTGEAPVENHKWVIH 119 Bacillus clausii KSM-K16
WP_013372405            64 IGSQATMQADHMAGMNGATATIVGAYTTTAYTVSYTPTTGGEKVTNHKWVIH 115 Paenibacillus
WP_015844601            58 PGSKAIMQDDHMKGMKGAVATIVGAYQTTAYVVNYTPTTGGEKVLNHKWVIQ 109 Paenibacillus sp. JDR-2
WP_013860065            63 TGSQVVIHADHMEGMNGAKATVKAAYATTVYAVNYKPVTGGAEVKNHKWVVQ 114 Bacillus coagulans
BAH43740                59 iGSEVILKANHAPGMQGAKAKIVAAYDTTAYSVTYTPTTGEPPVKNYKWIIQ 110 Brevibacillus brevis NBRC 100599
WP_014868556             6 VGDQVILKADHMPGMKGAKASIIAAKLSNVYQITYTPTNGDSQVTHHKWIIQ 57  Melissococcus plutonius
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap