Conserved Protein Domain Family
Shugoshin_N

?
pfam07558: Shugoshin_N 
Shugoshin N-terminal coiled-coil region
The Shugoshin protein is found to have this conserved N-terminal coiled-coil region and a highly conserved C-terminal basic region, family Shugoshin_C pfam07557. Shugoshin is a crucial target of Bub1 kinase function at kinetochores, necessary for both meiotic and mitotic localization of shugoshin to the kinetochore. Human shugoshin is diffusible and mediates kinetochore-driven formation of kinetochore-microtubules during bipolar spindle assembly. Further, the primary role of shugoshin is to ensure bipolar attachment of kinetochores, and its role in protecting cohesion has co-developed to facilitate this process.
Statistics
?
PSSM-Id: 400100
View PSSM: pfam07558
Aligned: 49 rows
Threshold Bit Score: 42.5975
Threshold Setting Gi: 194194594
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O13734        13 LKKKQIRQYKEIIRISKAQSIRIKELQLENERLLSENIDLRTTAI 57  Schizosaccharomyces pombe 972h-
Q4QSC8        37 NKPVALADITNTGKPNAARSITVPDLVKENTKLLTL-LNEKTKII 80  Zea mays
XP_012819711  33 MKEKRIKKLAKVATGSKTLCTKVQILNNGSTAIKNYKANNTALAL 77  tropical clawed frog
XP_016082865  22 MKEKRNKKLAKLGKTNSILSAKCKIITNNSTQLKSFQENNRALAL 66  platypus
Q9CXH7        22 MKEKRNKNLAGIGKRKSFIVAPGQVPTNTATLLRYYQDNNRLLVL 66  house mouse
XP_012024690  22 IKEKRSKNLTEI-KRKSLIIAPCQTITNTSKVL-SYEDNNRMLAL 64  mouflon
EDX08170       5 VEQQYKLLNAELMDQVQKQRLEIGEYRKRVISLEREIMDIREEHV 49  Drosophila simulans
Q18412        27 pTINFKSANDSLVKKNLLLKQQVVQCTKTIEKLRNENVALRQKNQ 71  Caenorhabditis elegans
EGV65365      38 NTEKYVLQNKTLTRNNEIMTTKLLQMEKRVADLINENVSLRAnkt 82  Yamadazyma tenuis ATCC 10573
EDK41237     144 VQRTYVLQNQALARNNSVLMSRISEMEARLNSVVNENMTLRTLRN 188 Meyerozyma guilliermondii ATCC 6260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap