5DIY


Conserved Protein Domain Family
NAGidase

?
pfam07555: NAGidase 
Click on image for an interactive view with Cn3D
beta-N-acetylglucosaminidase
This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
Statistics
?
PSSM-Id: 400097
View PSSM: pfam07555
Aligned: 80 rows
Threshold Bit Score: 317.203
Threshold Setting Gi: 429128626
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5DIY_B          8 GIIEGFYGKPWEHQERLDMFEFMQANNLNAYIYAPKQDLYHRE-LWREPYKEEQLQLFKELIEKAGSCGINFTFAISPGL 86   Thermobaculum...
CDE60529      150 GIVEGYYGKPMDFETHLRMFGYYGANKMNIYLYGPKDDPYHSSpHWRQPYPEKEAQEIREMARVARNNGLDFVWAIHPGK 229  Parabacteroid...
CCX60891      152 GVVEGFYGTPWSHEARLRQLEFYGRNKMNVYLYGPKDDPYHSTpNWRKPYPEREAAQLKELVDKAKENNVIFYWAIHPGQ 231  Bacteroides s...
CDA44457      154 GTVEGFYGTPWSHKARLSQIEFYGRNKMNVYIYGPKDDPYHRN-HWRVPYPDEEARRIQELNEHAKQCGVNFYWAIHPGV 232  Prevotella sp...
CCY16731      151 GVVEGFYGTPWTHEARLRQLDFYGQNKLNVYLYGPKDDPYHSVpNWRKPYPEKEAAQLRELVARAKANGVLFYWAIHPGA 230  Prevotella sp...
CDF22689      194 GVVEGFYGTPWSHEARMRQLDFYGMNKLNVYLYGPKDDPYHSVpRWREPYPEKEAAQLKQLVEEAHKNGVVFYWAIHPGQ 273  Prevotella sp...
wustl:BD1116  152 GTVEGFYGQPWSHADRIEQIRFYGRIKLNTYIYGPKDDPYHSSpNWRKPYPAEEAEHIKELAKEAAHNKVNFVWAIHPGQ 231  Parabacteroid...
jgi:Amuc_0052 129 GTVEGFYGTPWSHEARLSQLRFYGQNKMNTYIYGPKDDPYHSSpHWRDPYPADQAAQIRELVKVAKENHVDFVWAIHPGK 208  Akkermansia m...
CCX62796      154 GVVEGFYGTPWSHEARMSLIDFCSDHKLNTYIYGPKNDRYHRA-RWRQLYPEAEARQLQSLVARAREKEVDFVWAVHPGD 232  Bacteroides s...
CDF22966      146 GVVEGFYGNPWSETDRKRQFAFYGANKMNIYIYGPKDDPYHRN-RWRENYPADKAAELKRLIEAAHKYKVQFTWALHPGL 224  Prevotella sp...
5DIY_B         87 slvysSEEELETLIRKITPFLEMGVHSIGIFFDNVPFDliheedrnsySNLAEAQADFLTRVLQRLESti-stPQIIMCP 165  Thermobaculum...
CDE60529      230 di-rwNQADRDSVILKFESMYQLGVRAFAVFFDDISGE----------GAKADKQVELLNYINEHFIHqkpdvKPLIMCP 298  Parabacteroid...
CCX60891      232 di-kwNDEDRQNLLNKFEKMYQLGVRGFAVFFDDISGE----------GTKADKQADLLNYLDDHFVKvkgdvEPLIMCP 300  Bacteroides s...
CDA44457      233 di-kwNDADRDALMAKLEKMYQLGIRSFAVFFDDIWGE----------GTKADKQAALLNYVDDNFIKshkdvKPLIMCP 301  Prevotella sp...
CCY16731      231 di-kwNATDRDLLLAKFEHMYELGVRAFAVFFDDISGE----------GAKADKQANLLNYIDDNFVAkkgdvAPLVMCP 299  Prevotella sp...
CDF22689      274 di-kwNTEDRDKLMHKFELMYQLGVRAFAVFFDDISGE----------GTRADKQAELLNYLDDHFVKakkdvAPLVMCP 342  Prevotella sp...
wustl:BD1116  232 di-qwNQTDSMNILSKFGKMYDLGVRSFAVFFDDISGE----------GARPEKQAGLLNYIHKEFIRkksdvQPLIMCP 300  Parabacteroid...
jgi:Amuc_0052 209 di-kwTEEDMNNVIKKFEMMYKLGVRSFAVFFDDIFGE----------GKRGDMQALLLNKINDEFVKvkkdvTPLVMCP 277  Akkermansia m...
CCX62796      233 di-kwNEEDRDKLVAKLESMYQLGVRAFAVFFDDI-GK----------GKNAAEQADLLNYINQNFIQakgdvRPLIMCP 300  Bacteroides s...
CDF22966      225 di-kwNKTDSLNVLNKLESVYQLGCRRFAIFFDDISGD----------GGKAANQAALLNYVTEEFIHkh-nlEPLIMCP 292  Prevotella sp...
5DIY_B        166 TFYCNDPn----LEYLRILGQRLPKNIDVFWTGPNVCsHEITTSHMQEVQKSLQRPATLWDNYPVNDGgmMPE-LHIGPY 240  Thermobaculum...
CDE60529      299 TEYNREWtd-pkNQYLETLGSKLNPDIAIMWTGNSVI-CNIQQEDMDWINERIKRKAFIWWNYPVNDY--VMDhLLLGPV 374  Parabacteroid...
CCX60891      301 TEYNKAWsn-vkGGYLTTLGEKLNKGIQIMWTGNSVI-ATIDRETMDFINPLLKRKAYIWWNFPVSDY--VRDhLLMGPV 376  Bacteroides s...
CDA44457      302 TEYNRSWan-daGGYLRTLGTKMNKDIQIMWTGNSVV-HCIDKESMEWINQRIDRKAYIWWNFPVSDF--VRDhILLGPA 377  Prevotella sp...
CCY16731      300 TEYNKAWan-paGGYLHTLGTKLNDDIEIMWTGNSVV-HCIDKASMEWINDQIDRKAYIWWNYPVSDF--CRDhLLMGPV 375  Prevotella sp...
CDF22689      343 TEYNRAWss-dkTGYLRTLGKKLNKSIEVMWTGNSVV-HCIDKPSLEWINERIERKAYIWWNYPVSDF--VRDhLLMGPV 418  Prevotella sp...
wustl:BD1116  301 TEYNRSWa---kTDYLDILGTQLDPAIQIMWTGDRVV-ADITKEGVEWVNNRIRRPAYIWWNFPVSDY--CQDhLLMGPA 374  Parabacteroid...
jgi:Amuc_0052 278 TEYNRGWanpkpGTYLDILGDRLDPSIHVMWTGNSVC-HDITLEGQQWVNRRIKRPSYVWWNFPVTDY--CRSnLCMGRV 354  Akkermansia m...
CCX62796      301 SDYNRSRwh-peTAYLETLGDKLDANIHIMWTGDRAL-SDITADNLTWVQTILKRRPYIWWNFPVTDF--SNDrILMGKV 376  Bacteroides s...
CDF22966      293 TAYNRAYm---sGDYLQVLGANTDPEVHIMWTGNSVV-DMINKSDLDYVNPIIKRNAYIWLNYPVNDY--CIDhMLMGKL 366  Prevotella sp...
5DIY_B        241 DHRDPE--LHThVVGIYANPMALPEASKLPLYTFAQYLNSPSQYNPQDSWRQAVSTLLgEDNLSAMEKF 307  Thermobaculum terrenum
CDE60529      375 YGNSLY--IADkMSGFVSNPMEHAEASKVAVFGIADYCWNMEAFDGEKSWNLVLKELM-PTDADAFKLF 440  Parabacteroides sp. CAG:409
CCX60891      377 YGNALD--IKDeMEGFVSNPMEHAEASKIALYSVADYAWNLSDYDSDLSWKRAIKDLM-PQHAAYLETF 442  Bacteroides sp. CAG:598
CDA44457      378 YGNGLD--IANdMSGFVSNPMEHAEASKISLYGIADYTWNMKAYDYKADWEKGLKAVL-PDNYEALRTF 443  Prevotella sp. CAG:5226
CCY16731      376 YGNGLD--IKDdVAAFVSNPMEHAEASKVALYSVADYAWNMDEYDSRQSWQRALRTLL-PNCAEEFRTF 441  Prevotella sp. CAG:755
CDF22689      419 YGNGLD--IAGdMSAFVSNPMERAEASKVALYSIADYTWNMEQYDSIQSWHRSLMNLL-PRQGKQLEVF 484  Prevotella sp. CAG:617
wustl:BD1116  375 YGLDTQ--AAGtMTGFVSNPMEYAEASKVAIFGVGMYTWNIENYDPTQAWKDACDFIM-PEASMAFRIF 440  Parabacteroides distason...
jgi:Amuc_0052 355 YGLATEpgAREsMGGFVSNPMDKPEASKVSLFGLADYSWNINGFKSEESWKEGVRRLF-PKAAEAMQVF 422  Akkermansia muciniphila ...
CCX62796      377 IGITPA--IRTdASAFVSNPMEYAEASKLALFSVANYTWNINAYDAEASWQEGIRSLL-PDAAEAFACF 442  Bacteroides sp. CAG:598
CDF22966      367 YGNDQN--IAEqLSGFTSNPMEYAEASKVALFSLADYTWNMADYNPQQSWERAISYLM-PEHKEAFRTF 432  Prevotella sp. CAG:617
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap