Conserved Protein Domain Family
DUF1534
?
pfam07551: DUF1534 
Protein of unknown function (DUF1534)
This family is found in a group of small bacterial proteins. Its function is not known.
Links
?
Statistics
?
PSSM-Id: 148905
View PSSM: pfam07551
Aligned: 3 rows
Threshold Bit Score: 55.7752
Threshold Setting Gi: 123639007
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Download Cn3D
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
Q48QI7 128 LSFRTLQRGNAVRDAPRHRSAPRRAFKIGRGAPHDSVslNWPPQSTRA 175 Pseudomonas savastanoi pv. phaseolicola 1448A
Q48QI7  36 LSFRTLQRGNAVSDAPRHRFAPRRAFKIGRRASRTAC--DAERRTIVR 81  Pseudomonas savastanoi pv. phaseolicola 1448A
Q4ZM69  10 VSFLTLQRGSAVGDALRHRSAPCCTFGIGRGASRNAYprGAWV----R 53  Pseudomonas syringae pv. syringae B728a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap