5Z2Q


Conserved Protein Domain Family
Vg_Tdu

?
pfam07545: Vg_Tdu 
Click on image for an interactive view with Cn3D
Vestigial/Tondu family
The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. Transcriptional activation by these proteins likely requires interactions with specific coactivators. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed. This short conserved region is needed for interaction with Sd.
Statistics
?
PSSM-Id: 400091
View PSSM: pfam07545
Aligned: 14 rows
Threshold Bit Score: 55.063
Threshold Setting Gi: 198414019
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Z2Q_D        17 EWNAGSVIFTYFEGDINSMVDEHFSRALRN 46  house mouse
XP_012408758  26 ERSSRYVLFTYFQGDINSVVDEHFSRALSN 55  Tasmanian devil
XP_018961644  52 YLSARCVVFTYFRGDIGDVVDEHFSRALSQ 81  common carp
EEC17208     101 YLSANCVVFTYYSGDISSVVDEHFSRALSQ 130 black-legged tick
EFX86704     239 YISANCVVFMSYSGDTASVVDQHFSRALNa 268 common water flea
Q26366       283 YLSASCVVFTNYSGDTASQVDEHFSRALNY 312 fruit fly
EGI65981      95 YVNANCVVFTHYRGDAASEVEEHFQRALAH 124 Panamanian leafcutter ant
XP_011681060 150 YVNSHCVIFTFYSGDLDKIVDEHFSRSLSH 179 purple sea urchin
XP_002128412 109 HISSRCVMFNYFDGETSNEVDEHFTRALNH 138 vase tunicate
VTJ61088      22 EWNSQCVIFTYFQGDINSVVDEHFSRALSN 51  woodchuck
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap