2CKC,2V0F,6SY2,2DL6


Conserved Protein Domain Family
BRK

?
pfam07533: BRK 
BRK domain
The function of this domain is unknown. It is often found associated with helicases and transcription factors.
Statistics
?
PSSM-Id: 400080
View PSSM: pfam07533
Aligned: 54 rows
Threshold Bit Score: 60.9854
Threshold Setting Gi: 341903807
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2CKC_A         22 DPDTRIPVINLEDGTRLVGEDAPKNKDLVEWLKLHPTYTVDMP 64   human
XP_006003609  509 MSDLPVKVIHTETGKVLHGVDAPKSSQIDAWLEMNPGYEVAlr 551  coelacanth
Q7PRH5        628 ASDCRVTVMETATGKMISGDDAPFLRDLHSWLQLHPGWEYVIs 670  Anopheles gambiae str. PEST
Q17BI9        491 AHDCRVTVVETSSGKTIAGDDAPFLRDLYNWLQIHPGWEYVIs 533  yellow fever mosquito
XP_001957327  646 VADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDd 688  Drosophila ananassae
EEZ97706      423 GPDRPVTVVETATGKKLSGEDAPMLSQLQEWLLQHPGWEAMds 465  red flour beetle
XP_002424060  528 NSDLHVSVVETSTGKTLTGDEAPLASEVDSWLESHPGWEILDd 570  human body louse
XP_001947872  686 QSDMHVSVYEPSTGRMFKGEEAPLASQLNNWLDAHPGWEVMee 728  pea aphid
OWR47383      770 TSDSRVSVMDPKSGEVLKGEEAPLLSQLKDWMETHPGWEVLSD 812  Danaus plexippus plexippus
XP_025018665  282 QSDVRINVMETSTGKVLVGKEAPLASQLETWLEMHPGYEVAPR 324  two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap