Conserved Protein Domain Family
DUF1523

?
pfam07509: DUF1523 
Protein of unknown function (DUF1523)
Statistics
?
PSSM-Id: 400063
View PSSM: pfam07509
Aligned: 21 rows
Threshold Bit Score: 204.509
Threshold Setting Gi: 81732413
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q28UB0                1 MRWPRIISLLIVLSIIGTFAHYTLPQRDVVRIVRAESLLTDVEGfNRYFYSSPDSGTSGAST-ARDIRYINTIRAd---- 75  Jannasch...
rhodo:RCAP_rcc00543   4 VKW---TFWLLIAVICGSLLHYTLPRHEIVRVVNIYQERQDLSGwTSIFWSGPK--VKSGTQtSYDVQFISSVTP----- 73  Rhodobac...
Q9CKE6                5 FKYFFLTVIFVFHLVLFATVNFVTPSYEVTKVTGVEVKRVDKDG--------PITKANPADGpTRDVYFINTQNQ----- 71  Pasteure...
jgi:HSM_0517          5 fKKVVLGLLFLFHVFLFSVVHYVTPHYDVTKVTGVEVKRVDKDG--------PITKANPADGpTRDVYYIYTQKPn---- 72  Histophi...
Q65V31                8 IKYFLLTVVFVFHVVLFAGINYVFPHYETTKITGVEVKRVDKDG--------PITKANPADGpTRDVYYIYTQQPd---- 75  [Mannhei...
WP_012073592          5 iKYFLITVVVLFHAVLFAGIHFVFPHYETTRVTGVEVKRVDKDG--------PITKANPQDGpTRDVYYIYTQRAd---- 72  Actinoba...
P43999                5 FKYFLFIVVFLFHGFMFSVVNYVFPHYDVTRVTGVEVKRVDKDG--------PITKSNPADGpTRDVYYINTQND----- 71  Haemophi...
Q7VKH1                5 IKYFLIFISLSFFSILALTVNYAMPSYDDTIVTGMEVRRMDKDG--------IISKSNPADGqIRDVYFLFTENStdaqg 76  [Haemoph...
O24871                7 VRNVVLFILTAIFLAFMLLVSYCMPHYSAAVISGVEVKRMNENE--------NTPNNKEVKTlARDVYFVQTYDPk---d 75  Helicoba...
Q888T4                4 LKRSIWLVVFVALGIGALSLYYVLPRHDVVMITGVEVKRMDADG--------VVNAENPADGpTRDVYFINTEDPd---- 71  Pseudomo...
Q28UB0               76 DGTVMVYRNEDTGLLWPPYFKFDSQDLQTEAANLESTENDPIWVAVTHYGWRSNWISIYPNALSIERVENRDVTLFPWPT 155 Jannasch...
rhodo:RCAP_rcc00543  74 EGKPKVYRNQDTGWGWPPYFKFDTANLATQAANQQSNAESPKWVDVTYYGWRSELFSIFPNAVSIKPVDGPDVSIVPWFN 153 Rhodobac...
Q9CKE6               72 DGKIMVYRNEDTRWGFPFYFKFGSANLHAEAEALIKEG---QKVQIKYYGWRLVMFDEFRNALNIKAVDEHASPSHPIFA 148 Pasteure...
jgi:HSM_0517         73 EENVMVYRNEDTRWSFPFYFKFGSADLQAKAQSFSVDH---KLVEIKYYGWRLVMFDEFRNAVSVKEVSADTEASHSILA 149 Histophi...
Q65V31               76 KQKPMVYRNEDTRWGFPFYFKFGSADLQAKASTFAQDQ---RLVEIKYYGWRIVMFDEFRNAVSMREVTEDS-GSHPILS 151 [Mannhei...
WP_012073592         73 ELKPTVYRNEDTRWGFPFYFKFDSAVQQARASGFAQNK---KMVEVKYYGWNIVMFNEFRNVISMKEVTEEQ-GSHPILS 148 Actinoba...
P43999               72 DGKIMVYRNEDTRWGFPFYFKFGSANLQAEAQALGNDN---KLVQIKYYGWRITMVDEYRNATSIKEITADDTPSNPIVS 148 Haemophi...
Q7VKH1               77 AKEVMVYRNEDTGWGLPPYFKFSSADLQAKAQAYANER---QRVQIKYYGWRIKWLNEFPNIVSIKPLAENETKSMPFFS 153 [Haemoph...
O24871               76 QKSVTVYRNEDTRFSFPFYFKFNSADISALAQSLIN-----QQVEVKYYGWRINLFNMFPNVIFLKPLKESTDISKPIFS 150 Helicoba...
Q888T4               72 TKKVVVYRNEDTAWSFPWYFKFDSADIQAKAQGYSRDAQ--QLALIRYYGWRITILSMFPNVTEIEAVTSRD-QPFPVFN 148 Pseudomo...
Q28UB0              156 VIVLLVFAAFIFMAWRIWERF 176 Jannaschia sp. CCS1
rhodo:RCAP_rcc00543 154 IVFLTLLVMAILTVRALWIQF 174 Rhodobacter capsulatus SB 1003
Q9CKE6              149 YILYFILLITLFFSVQFIRGW 169 Pasteurella multocida
jgi:HSM_0517        150 YVFYAFLLITLFFSIQFVRGW 170 Histophilus somni 2336
Q65V31              152 YIFYFLGIITLFFSIQLIRGW 172 [Mannheimia] succiniciproducens MBEL55E
WP_012073592        149 YVFYLLGLLSMIISIQFIRGW 169 Actinobacillus succinogenes
P43999              149 WILYVFLLATLFLSIQFIRGW 169 Haemophilus influenzae Rd KW20
Q7VKH1              154 YVLYAVLLLLFFLSIQMIRGW 174 [Haemophilus] ducreyi
O24871              151 WILYALLLMGFFISARSVCTL 171 Helicobacter pylori
Q888T4              149 TVFFVVVGLLVVIVVVGVRRR 169 Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap