Conserved Protein Domain Family
Tir_receptor_C

?
pfam07489: Tir_receptor_C 
Translocated intimin receptor (Tir) C-terminus
Intimin and its translocated intimin receptor (Tir) are bacterial proteins that mediate adhesion between mammalian cells and attaching and effacing (A/E) pathogens. A unique and essential feature of A/E bacterial pathogens is the formation of actin-rich pedestals beneath the intimately adherent bacteria and localized destruction of the intestinal brush border. The bacterial outer membrane adhesin, intimin, is necessary for the production of the A/E lesion and diarrhoea. The A/E bacteria translocate their own receptor for intimin, Tir, into the membrane of mammalian cells using the type III secretion system. The translocated Tir triggers additional host signalling events and actin nucleation, which are essential for lesion formation. This family represents the Tir C-terminal domain which has been reported to bind uninfected host cells and beta-1 integrins although the role of intimin binding to integrins is unclear. This intimin C-terminal domain has also been shown to be sufficient for Tir recognition.
Statistics
?
PSSM-Id: 369388
View PSSM: pfam07489
Aligned: 6 rows
Threshold Bit Score: 209.103
Threshold Setting Gi: 139004406
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O85506       334 IENNAQAQKKYDEQQAKRQEELKVSSGAGYGLSGALILGGGIGVAVTAALHRKNQPVEQTTTTTTTTTtts--------- 404 Escherichia coli
B7UM99       337 VESNAQAQQRYEDQHARRQEELQLSSGIGYGLSSALIVAGGIGAGVTTALHRRNQPAEQTTTTTTHTV------------ 404 Escherichia col...
WP_012907112 335 VESNAQAQQRHDDQQAKRQQELDLSSGIGYGLSSALIVGGGIGAGVTAMLHRRNPPTEQ-TIATTHSV------------ 401 Citrobacter rod...
WP_001121330 326 IESNSQAQQKYDEQHAKREQEMSLSSGVGYGISGALILGGGIGAGVTAALHRKNQPAEQ--TITTRTV------------ 391 Escherichia coli
ABT17080     290 IESNAQAQARYNEQHEKRQEELNTSSGAGYGLSGALILGGGIGLGVTTLLHRRNQPVEQTSTTTTTTTath--------- 360 Escherichia coli
BAF52549     333 LESNAQAQKRYDDQQAKRQQELNVSSGAGYGLSGALILGGGIGAVVTAALHRRNQPVENRTTTTTTTTttttttgagaga 412 Escherichia col...
O85506       405 -------artVENKPANNTPAQG---NVDTPGSED-TMESRRSSMASTLS-TFFDTSsIGTVqNPYADVKTSLHDSQVpt 472 Escherichia coli
B7UM99       405 ----------VQQQTGGNTPAQG---GTDATRAED-ASLNRRDSQGSVAStHWSDSS-SEVV-NPYAEVGGARNSLSA-- 466 Escherichia col...
WP_012907112 402 ----------IQQQTGGNTRAQG---GADTTGVEN-ASLTRRDSQASVAStQWSDTS-GDVV-NPYAEGWMSRNNPSL-- 463 Citrobacter rod...
WP_001121330 392 ----------VDNQPTNNASAQG---NTDTSGPEE-SPASRRNSNASLAS-NGSDTSsTGTVeNPYADVGMPRNDSLA-- 454 Escherichia coli
ABT17080     361 --------ttAGNKPADNTPASG---NTESSGAEEpTASRRNSETGSTASaSPSDTSsIDTVdNPYADVGRTSRQ----- 424 Escherichia coli
BAF52549     413 gagagavenkAENKTTNDTSAQGaqvNADTSGPEEgTASSRRNSVTSTSS----DTSsTDTVvNPYAEVNVSVNDSQIpg 488 Escherichia col...
O85506       473 SNSNTSVQNMGNTDsVVYSTIQHPPRDTTDNgARLLGNPSAGIQSTYARLALRGGLRHDMGGLTGGSNSAVNTSNNPPAP 552 Escherichia coli
B7UM99       467 HQPEEHIYDEVAAD-PGYSVIQNFSGSGPVT-GRLIGTPGQGIQSTYALLANSGGLRLGMGGLTSGGESAVSSVNAAPTP 544 Escherichia col...
WP_012907112 464 LAPEEPIYDEVAPD-PNYSVIQHFSGNNPVT-GRLVGSPGQGIQSTYALLASSGGLRLGMGGLTGGGESAGSAANAATTP 541 Citrobacter rod...
WP_001121330 455 RISEEPIYDEVAAD-PNYSVIQHFSGNSPVT-GRLVGTPGQGIQSTYALLASSGGLRLGMGGLTGGGESAVSTANAAPTP 532 Escherichia coli
ABT17080     425 ELPEEHIYDQVAADePIYANIQRSAGDAPDGrVRLMGNPGAGIQS----------------------------------- 469 Escherichia coli
BAF52549     489 RNSEVPVQNEGGASsVIYSTVQSRPQDTPDS-PRLLGNPGRGVQHAYALLSMSGGLQNGLGGLTGGA-GAASTPNNPPAR 566 Escherichia col...
O85506       553 GSHRFV 558 Escherichia coli
B7UM99       545 GPVRFV 550 Escherichia coli O127:H6 str. E2348/69
WP_012907112 542 GVERFV 547 Citrobacter rodentium
WP_001121330 533 GPARFV 538 Escherichia coli
ABT17080     470 -----V 470 Escherichia coli
BAF52549     567 GSDRFV 572 Escherichia coli NT:H19
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap