Conserved Protein Domain Family
W_rich_C

?
pfam07483: W_rich_C 
Tryptophan-rich Synechocystis species C-terminal domain
This domain is found at the C-terminus, normally between 2-3 copies, of a range of Synechocystis membrane proteins. This domain is fairly tryptophan rich as well.
Statistics
?
PSSM-Id: 400042
View PSSM: pfam07483
Aligned: 16 rows
Threshold Bit Score: 101.707
Threshold Setting Gi: 123161404
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q89HG4         416 TALVLDGSYYDLNPTAGGA-------GPTLKNGGAAVIAGNYGAWSPVAAEQVSgGGYDVAWKNASTGYFSVWSTDSNGN 488  Bradyrhizobi...
BAG04844       345 ITLVRDSANRLSARSSEETlplysleDTPLQIGQY-------PDWQALAVERID-GLNQILWKNTRNNYLQVWYTDTNWR 416  Microcystis ...
P73590        2920 TSFLEGIFGNYYVQTGDDL-------TAPIKYLGEVFENNF-GDWQGLAAETVN-GINQVLWQNLETSEIGVWSTDSNWN 2990 Synechocysti...
P74649        1190 ISLLRGIFG-YHVQTGDGL-------TTPLRYLGEAFENDI-GNWQALAAETVE-GINQVLWQNQSSGEIGVWYADSNWN 1259 Synechocysti...
P72939        1303 VSLLEGILGNYYVQSGDDL-------TTPIKYLGEAFDNNL-GNWQALAAETVQ-GVNQVLWQNLDTNQIGVWNSSADWN 1373 Synechocysti...
P73089        1757 VAVIEN--GFFFAQFLDNT-------RQALLFQNQPFSTDQSVNWKILDTETVD-GSNQVLWYNQVTEEVGVWLTDNNWN 1826 Synechocysti...
P72939        1189 IGVVAEN-GFFFVLLPGGD-------EVQLKFNNQPFASGTFGNWQILEAETVN-GINQVLWQNPNLGQIGVWNADSNWN 1259 Synechocysti...
P73590        2806 ISVVAKD-NLFFVQLPDGS-------EVSLLYEDQPFVSGSFGNWQILEAETIN-GVNNVLWQNPDIDEIGVWNADSNWN 2876 Synechocysti...
tgen:AM1_2804  560 TASLLTTAVGYQIQGQGET-------AQFVRLNGNVVSENTFSGWSAIGVEKLG-QGFQLLWKNVDGRYLD-WRVDAKGT 630  Acaryochlori...
WP_050766314   947 vaIVRDTLNRLYARTSLGDtaigainGTPLTETSN-------PGRQILGAETLN-GINQIVWRNTTTNALELWTMDGDWQ 1018 Microcystis ...
Q89HG4         489 FVSTLTPEVPGSDSRLiALETSFHQDLNGDGSIG 522  Bradyrhizobium japonicum
BAG04844       417 WLGGDSTNGLNTLDAY-NLEKKFQFDANGDGRIG 449  Microcystis aeruginosa NIES-843
P73590        2991 WLSSD-VFAAGSLQAL-EQQLIFAVDVN------ 3016 Synechocystis sp. PCC 6803
P74649        1260 WVFSN-VFVPGSSQAL-AQFNAFGVAIN---ETG 1288 Synechocystis sp. PCC 6803
P72939        1374 WISSN-VFEAGSPQAI-AQAEIFGIPTTvlttad 1405 Synechocystis sp. PCC 6803
P73089        1827 WISSD-TWQVKSSRTF-NTELLFGTDINGDSLIG 1858 Synechocystis sp. PCC 6803
P72939        1260 WISSQ-TWPTNSFNTL-EAEVTFQIDINNDDLLG 1291 Synechocystis sp. PCC 6803
P73590        2877 WISSE-TWPTNSFNTL-EAEINFQIDLNGDELLG 2908 Synechocystis sp. PCC 6803
tgen:AM1_2804  631 YQSSQSI----SQTELtNLETTFLQDLNGDTQVG 660  Acaryochloris marina MBIC11017
WP_050766314  1019 FAGNDAPIAPTSPTAL-QLELDFEMDLNGDTVIG 1051 Microcystis aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap