Conserved Protein Domain Family
MSP1_C

?
pfam07462: MSP1_C 
Merozoite surface protein 1 (MSP1) C-terminus
This family represents the C-terminal region of merozoite surface protein 1 (MSP1) which are found in a number of Plasmodium species. MSP-1 is a 200-kDa protein expressed on the surface of the P. vivax merozoite. MSP-1 of Plasmodium species is synthesized as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19-kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate.
Statistics
?
PSSM-Id: 400028
View PSSM: pfam07462
Aligned: 3 rows
Threshold Bit Score: 751.41
Threshold Setting Gi: 156097618
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001614842 1001 VggNSEEKPE---ADTAQVEKFYEKHLSQIDKY-NDYFQKFLESQKDEITKMDETKWKALGAEIEELKKKLQVSLDHYGK 1076 malaria paras...
P13828       1060 R--SRAESEEdmpADDFELDNLYKSYLQQIDGN-NTEFINFIKSKKELIKALTPEKVNQLYLEIAHLKELSEHYYDRYST 1136 Plasmodium yo...
Q8I0U8        981 NlgNKTKVPNpltISTTEMEKFYENILKNNDTYfNDDIKQFVKSNSKVITGLTETQKNALNDEIKKLKDTLQLSFDLYNK 1060 Plasmodium fa...
XP_001614842 1077 YKLKLERLLKKKNKISNSKDQIKKLTSLKNKLERRQNLLNNPTSVLKNYTAFFNKKRETEKKEVENTLKNTEILLKYYKA 1156 malaria paras...
P13828       1137 YKLKLERLYNKHEQIQLTNRQIRDLSILKARLLKRKQTLNGVFYILNGYVNFFNKRREAEKQYVDNALKNTDMLLKYYKA 1216 Plasmodium yo...
Q8I0U8       1061 YKLKLDRLFNKKKELGQDKMQIKKLTLLKEQLESKLNSLNNPHNVLQNFSVFFNKKKEAEIAETENTLENTKILLKHYKG 1140 Plasmodium fa...
XP_001614842 1157 RAKYYIGEPFPLKTLSEESMQKEDNYLNLEKFRVLSRLEGRLGKNIELEKENISYLSSGLHHVLTELKEIIKNKKYSGND 1236 malaria paras...
P13828       1217 RTKYFTSEAVPLKTLSKASLDRESNYLKIEKFRAYSRLELRLKKNINLGKERISYVSGGLHHVFEEFKELIKDKDYTGKK 1296 Plasmodium yo...
Q8I0U8       1141 LVKYYNGESSPLKTLSEVSIQTEDNYANLEKFRVLSKIDGKLNDNLHLGKKKLSFLSSGLHHLITELKEVIKNKNYTGNS 1220 Plasmodium fa...
XP_001614842 1237 HTKNIAAVKEALQAYQELIPK---VTTQEGASTTAATLPVTvpsAVPGGl--PGAGvPGAAAGLTPPPPAGSVPATGpga 1311 malaria paras...
P13828       1297 NPDNAPEVTNAFEQYKELLPKgvtVSTPAVAVTTTLAADAP---ATPEGa-vPGAV-PGAVPGAVPGAVPGAVPGSG--- 1368 Plasmodium yo...
Q8I0U8       1221 PSENNKKVNEALKSYENFLP--------EAKVTTVVTPPqp--dVTPSPlsvRVSGsSGSTKEETQIPTSGSLltelqqv 1290 Plasmodium fa...
XP_001614842 1312 aagsteenvaakaqdyaedYDKVIALPLFGNNDDDGe-EDQVTTGEAESEAPEILVPAGISDYDVVYLKPLAGMYKTIKK 1390 malaria paras...
P13828       1369 -------------------TDTRVAGSSVDDNEDDD--IYQIASGQSEDAPEKDILSEFTNESLYVYTKRLGSTYKSLKK 1427 Plasmodium yo...
Q8I0U8       1291 v----------qlqnydeeDDSLVVLPIFGESEDNDeyLDQVVTGEAISVTMDNILSGFENEYDVIYLKPLAGVYRSLKK 1360 Plasmodium fa...
XP_001614842 1391 QLENHVNAFNTNITDMLDSRLKKRNYFLEVLNSDLNPFKYSSSGEYIIKDPYKLLDLEKKKKLIGSYKYIGASIDMDLAT 1470 malaria paras...
P13828       1428 HMLREFSTIKEDMTNGLNNKSQKRNDFLEVLSHELDLFKDLSTNKYVIRNPYQLLDNDKKDKQIVNLKYATKGINEDIET 1507 Plasmodium yo...
Q8I0U8       1361 QIEKNIFTFNLNLNDILNSRLKKRKYFLDVLESDLMQFKHISSNEYIIEDSFKLLNSEQKNTLLKSYKYIKESVENDIKF 1440 Plasmodium fa...
XP_001614842 1471 ANDGVTYYNKMGELYKTHLDGVKTEIKKVEDDI-----------KKQDEELKKlgnvnsqdskknefiakkaeleKYLPF 1539 malaria paras...
P13828       1508 TTDGIKFFNKMVELYNTQLAAVKEQIATIEAET-----------NDTNKEEKK----------------------KYIPI 1554 Plasmodium yo...
Q8I0U8       1441 AQEGISYYEKVLAKYKDDLESIKKVIKEEKEKFpssppttppspAKTDEQKKEs---------------------KFLPF 1499 Plasmodium fa...
XP_001614842 1540 LNSLQKEYESLVSKVNTYTDNLKKVINNCQLEKKEAE 1576 malaria parasite P. vivax
P13828       1555 LEDLKGLYETVIGQAEEYSEELQNRLDNYKNEKAEFE 1591 Plasmodium yoelii yoelii
Q8I0U8       1500 LTNIETLYNNLVNKIDDYLINLKAKINDCNVEKDEAH 1536 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap