Conserved Protein Domain Family
NUMOD3

?
pfam07460: NUMOD3 
NUMOD3 motif (2 copies)
NUMOD3 is a DNA-binding motif found in homing endonucleases and related proteins. It occurs on its own or in tandem repeats in GIY-YIG (pfam01541) and HTH proteins. It constitutes a beta-turn-loop-helix subregion of the the DNA-binding domain of I-TevI homing endonuclease.
Statistics
?
PSSM-Id: 400027
View PSSM: pfam07460
Aligned: 16 rows
Threshold Bit Score: 43.9481
Threshold Setting Gi: 82012481
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA38813       165 GYKHTDEAKLKMLNRFKDKsNHPMYGKKHTEQTLKLIS 202 Podospora anserina
jgi:AciX8_1848 165 GNKLTKAHRRKISDAVKGE-NHPSFGKKLSETTRQKMR 201 Granulicella mallensis MP5ACTX8
jgi:Bcav_0098  182 GHVMSLESREALSKARRGE-GNPNFGKVTSPETRAKQS 218 Beutenbergia cavernae DSM 12333
AEV76462       177 GHVVSEQTRAKLSEQKRGA-ANPNYGRRASEETRAKMS 213 Mycolicibacterium rhodesiae NBB3
Q6WI07          93 GYKHTDESKRKMSEAKKGT-TPHNKGKKASLESRRKMA 129 Vibrio phage KVP40
CBJ29049        33 GRPHTVASKAKISAANKGK-KPWNVGVGHSEETRRKIA 69  Ectocarpus siliculosus
EEC47469       207 GYTHTNASRAKISAANKGK-TPWNKGKSRSDETRAKIA 243 Phaeodactylum tricornutum CCAP 1055/1
EKM73624        32 GRKQSKETIAKLVAAIKGK-NSPMTGQKHSQKARQNLS 68  Agaricus bisporus var. burnettii JB137-S8
O41133          92 GRR-SEITKQRMSEAHTGK-VGYWYGKTRNETTKQKIS 127 Paramecium bursaria Chlorella virus 1
Q84603         138 GKQLSEETKKKMSEALRGE-KHYMFGKHHDEETKKKMS 174 Paramecium bursaria Chlorella virus 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap