Conserved Protein Domain Family
HycH

?
pfam07450: HycH 
Formate hydrogenlyase maturation protein HycH
This family contains the bacterial formate hydrogenlyase maturation protein HycH, which is approximately 140 residues long. This may be required for the conversion of a precursor form of the large subunit of hydrogenlyase 3 into a mature form.
Statistics
?
PSSM-Id: 400019
View PSSM: pfam07450
Aligned: 18 rows
Threshold Bit Score: 193.238
Threshold Setting Gi: 409106679
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011706331          4 EVFFYRLSRKFVDEQFDVPEEAKEVMYYSLAIGHHLGIVDCLRADLVCSLTGYRDWVAKLPEGsEARRKMEGFLTFGEIT 83  Aeromonas
P77453                7 EIVFWTLRKKFVASSDEMPEHSSQVMYYSLAIGHHVGVIDCLNVAFRCPLTEYEDWLALVEEE-QARRKMLGVMTFGEIV 85  Escheric...
CAR44982              6 KVYFWSLRQKFVDSDDDIPEQAQQVMYYSLAIGHHVGMIDCLKTELVCPLEKYQAWIDLLPEG-EAKRKMQGLLTFGEIN 84  Proteus ...
CCH:MU9_3447         14 KVIFWSLRQKFVDSDTDVPEEAQQVMYYSLAIGHHVGMIDCLNTELICPLSGYQSWVNALPEG-EARRKLQGLITFGEIN 92  Morganel...
Q6D7T7                5 QVIFWSLRQKFLDSES-VPEQPQQVMYYSLAIGHHVGVIDCLKAELTCDLDRYPQWTAMLGTG-DAQRKMNGLLTFGEIY 82  Pectobac...
WP_002445322          5 QVVFWSLRQKFIDTSD-MPEQSQQVMYYSLAIGHHVGIIDCLNTELICDLPQYTRWMTMLDNP-EAQRKFRGLLTFGEIN 82  Shimwell...
CBS89875             24 EVVFYQLNAKVLERKEDIPEDARQVVYYSLAIGHHIGVFDCFKPAFRCTTAVFDRVLETLKDNeEAHRKLSGLLRFGEIT 103 Azospiri...
Q20XP7                4 DVIFYRLNAKIMERDGDIPDDAKQVIYYSLAIGHHVGVFDCFKPVLRCKAEFFERLVAAMPEG-EARRKLDGLHRFGEIT 82  Rhodopse...
goetting:Tph_c26360   4 TVEFYRLNRKFVDSGE-ASPSSENLIYHSLALGHHIGVLDCFQKALVMPEKSFSRLTAGLPRS-EGRRKLEGILKWREIE 81  Thermace...
Q8R9B8                4 KVKFFKLSKRFVDEKD-APAEVEQLKYYALAIGHHIGIVDCLSPVMTMEEKDYLEWISKFPPG-KVRRKLEGLTKWGEIE 81  Caldanae...
WP_011706331         84 IYREHCHMLACAFDRLRKADnlLDEQELgWTNTFMDQLTALFNDPHMYLMVR 135 Aeromonas
P77453               86 IDASHTALLTRAFAPLADDA--TSVWQA-RSIQFIHLLDEIVQEPAIYLMAR 134 Escherichia coli K-12
CAR44982             85 INSEHTHMLALAFDPIAKSD--DPLFSE-WSQTLINLLGEIVIEPAIYLIVK 133 Proteus mirabilis HI4320
CCH:MU9_3447         93 IDSTHTNMLALALDPLTKDK--NPDFRE-WSATLIRLLGEIEREPAIYLIVK 141 Morganella morganii subsp. morganii KT
Q6D7T7               83 IDSTHVDMLAHALAPLAQTGqlEP-FQT-WSTTLLRLLAEIQQEPAIYLIVK 132 Pectobacterium atrosepticum
WP_002445322         83 IDSTHVNLLASALAPLTEEHiaEP-FRG-WSKTLMGLLEEIQHEPAIYLIVK 132 Shimwellia blattae
CBS89875            104 VDSTHTRPLMAAIEAVLPTA--PPDVAA-WLDRLRTALDAIRREPAIYLMGR 152 Azospirillum lipoferum 4B
Q20XP7               83 IDRSHTELLGAAIDQVSPSL--DSESAD-WLRELGVSLAAIEAEPAIYLMGR 131 Rhodopseudomonas palustris BisB18
goetting:Tph_c26360  82 IRSEQAGPLLREVEQVVPTL--PPEDKK-GAQEFCDLLRLMEKEPTIYLVVR 130 Thermacetogenium phaeum DSM 12270
Q8R9B8               82 INREHVALLVSTLSQAFPSF--LPEEKE-WANCLLKLLHSIQKEPAIYVVVR 130 Caldanaerobacter subterraneus subsp....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap