5B0V


Conserved Protein Domain Family
VP40

?
pfam07447: VP40 
Click on image for an interactive view with Cn3D
Matrix protein VP40
This family contains viral VP40 matrix proteins that seem to be restricted to the Filoviridae. These play an important role in the assembly process of virus particles by interacting with cellular factors, cellular membranes, and the ribonuclearprotein particle complex. It has been shown that the N-terminal region of VP40 folds into a mixture of hexameric and octameric states - these may have distinct roles.
Statistics
?
PSSM-Id: 400017
View PSSM: pfam07447
Aligned: 2 rows
Threshold Bit Score: 445.329
Threshold Setting Gi: 465460
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5B0V_B  16 ASSSNYNTyxQYLNPPPY-ADHGANQLIP-ADQLSNQQGITPnyvgdlnlddqfkGNVCHAFTLEAIIDISAYNERTVKG 93  Marburg virus - Musok...
Q05128  27 ARGGNSNT--GFLTPESVnGDTPSNPLRPiADDTIDHASHTP-------------GSVSSAFILEAMVNVISGPKVLMKQ 91  Ebola virus - Mayinga...
5B0V_B  94 VPAWLPLGIXSNFEYPLAHTVAALLTGSYTITQFTHNGQKFVRVNRLGTGIPAHPLRXLREGNQAFIQNXVIPRNFSTNQ 173 Marburg virus - Musok...
Q05128  92 IPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQY 171 Ebola virus - Mayinga...
5B0V_B 174 FTYNLTNLVLSVQKLPDDAWrpSKDKLIGN--TXHPAVSIHPNLPPIVLPTvkkqayRQHKNPNNGPLL------AISGI 245 Marburg virus - Musok...
Q05128 172 FTFDLTALKLITQPLPAATW--TDDTPTGSngALRPGISFHPKLRPILLPN------KSGKKGNSADLTspekiqAIMTS 243 Ebola virus - Mayinga...
5B0V_B 246 LHQLRVEKVPEKTSLFRISLPADXFSVKEGXXKKRGENSPVVYFQAPENFPL 297 Marburg virus - Musoke, Kenya, 1980
Q05128 244 LQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGL 295 Ebola virus - Mayinga, Zaire, 1976
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap