Conserved Protein Domain Family
PriC

?
pfam07445: PriC 
Primosomal replication protein priC
This family contains the bacterial primosomal replication protein priC. In Escherichia coli, this function in the assembly of the primosome.
Statistics
?
PSSM-Id: 400016
View PSSM: pfam07445
Aligned: 40 rows
Threshold Bit Score: 87.6833
Threshold Setting Gi: 81362738
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q47XP5             12 RLSTLLEHISVQAKQtdqlnskqkSHRLIENNNLFSQHLFTTESDKIFIYVEEVKKRLNEFSRLYALSGdnPNKAEFAks 91  Colwellia ...
Q8EFZ7             11 TLKNQLKTLEQEVLQhdsh-lvpsQRKLLQDIERFNQSLFIQHGAQLMPCIEQIRSSIVQLEKQIALKLa-PQTIAMS-- 86  Shewanella...
Q12LG5              9 NLRDKLAQLEQEVLQhdan-ipvsQGKMLQDVERFNNQLFIQQGAKLAPCIEQLQKSINQLEKQLSLKLd-TQLITLS-- 84  Shewanella...
Q07ZU2              9 MLKQQLAKLEQDALIhdqn-lapsQRQSLQEIERFNSQLFAQQGAQLSPCITQLRQDIKQLEKQLYLKLg-GNVIQLS-- 84  Shewanella...
WP_011770481       13 QLNRQLKVLSKRCEVld-----esVSQTENKCFVFEVHIFPKRCLTLLGYIKQIEHTAKSLQNALDKNLp-EALIAFE-- 84  Psychromon...
UNSW:PCNPT3_06530  14 QLQQQLLQLSQRCKPld-----ahLKQTENHYFAFEVHMFSKKSLTLMGYIKQIQTTLKNLNLIINKHLp-DSLINIE-- 85  Psychromon...
Q9CM53              9 ILTNKITQLDHKQR----------TATEQPLKTRFAPHLFSENNQVFSFYFQELKQTLTQLENAPETD---IALCAFF-- 73  Pasteurell...
WP_012073539       10 RLQRLITQLQKQYE----------PVKRQILHTKFDPAIFSENFQPLEFYLNEIRHCIEQISQLSPEE---VAQTAFF-- 74  Actinobaci...
Q65UQ3             10 QLQAKVQQLTLQFA----------AFSDKKIYAKFDRTLFSEDFESGQFYFDQIQHTLAQIAGLKETE---IPQIQFF-- 74  [Mannheimi...
jgi:HSM_1492        9 lLKQKVDEFFSRYSH---------IPSKQKIYAKFDRTLFSQDFESLSFYLKEVRQCLTQLEKINDDN---VQKYTFY-- 74  Histophilu...
Q47XP5             92 sLQRIEQQISALMNAIQSNQTMHQAAQASfdarknvrvkaakaaqlkqndvynkmaksvlLTSHQLYQ-----QLSEHHE 166 Colwellia ...
Q8EFZ7             87 -CERIQDRFTAVKRALLTTSIDVKSKNQQraskrarfaqqqnqs--hqasgfawiasnvlQNSHEIYA-----ELNKHLN 158 Shewanella...
Q12LG5             85 -CERIQDRFTAVKRALNTTNINIKTAQQQksskraffakrqqst--hassgfgwiagnvmHNSHEMYA-----ELNKHLN 156 Shewanella...
Q07ZU2             85 -CDRIQDRFSALRRALLTTHINLKSEQQRkasnraryakkqqqa--iqdsgfgwiasnvmQNSHQLYA-----ELNKHLN 156 Shewanella...
WP_011770481       85 -CTLFIDQFQVLLQLVQSLEKGEADILYKsy----------------------------sSIKENIYQ-----QLQKQYH 130 Psychromon...
UNSW:PCNPT3_06530  86 -CERFIAQYQLLLQLVICIEKGEEKKLYHsy----------------------------sNPKEKIYQ-----QLKKQYD 131 Psychromon...
Q9CM53             74 -AEKLLSQYVALSEALTHTQIKTETFTPTn------------------------------KATHHVHQlppreRLEKYYE 122 Pasteurell...
WP_012073539       75 -SEKLSAQYTALTDALQFIEKPKAKSAVNfkpvl----------------------slreKRRQQLEQlppraRLIKYYE 131 Actinobaci...
Q65UQ3             75 -SEKLLAQCTALSDAINQNNGRKTAPTPKips-------------------------qreKIKHELNQlppreRLVRYYE 128 [Mannheimi...
jgi:HSM_1492       75 -SEKLKGQCKALSEALSQTNAKTNIKFQHndtnlqs------------------vqerreKQRIALNKlppreRLSKYYE 135 Histophilu...
Q47XP5            167 FERRLRDMITEREQQRIRSKS-ANTEKLSQEVLALHQRLGRCRKAISSIERSIEQAE 222 Colwellia psychrerythraea 34H
Q8EFZ7            159 WAKKFEQKIAEMESKLENCHS-ADKISLQNDILLMHRRLGKCRQAISYIEDRIQAFE 214 Shewanella oneidensis
Q12LG5            157 WATKIEQKIAQMELNLPSCHP-NEKIQSQNDILSMHKRLGKCRQAISYIEDRIQFLE 212 Shewanella denitrificans OS217
Q07ZU2            157 WAKKIEQKIQQMEASLEFCHS-DDKIKLQNDILSMHRRLGKCKQATSYIEERIQLFE 212 Shewanella frigidimarina NCIMB 400
WP_011770481      131 YEERLLNMIAEQEELMTHSNA-QQKIDIKEKIEVLKGRYQKCNSYTQMLEFKfqdss 186 Psychromonas ingrahamii
UNSW:PCNPT3_06530 132 YEQRLLNMIAEQEEKLATSPA-FDAPEIRYKIDALKVRYQKCNAFTQNLEFKLEAMq 187 Psychromonas sp. CNPT3
Q9CM53            123 ALQALNEKLMSLQDSQQKTQAeQEKKLLGQKIQLTQQRKAKCLVAIETLEEYLvfkn 179 Pasteurella multocida
WP_012073539      132 ALQALNEKLNGQKDLQKQCLSeKEKMRIQQQIDITRQRRQRCLDAIEVLEEYLAFKE 188 Actinobacillus succinogenes
Q65UQ3            129 ALQALNEKINELEDKRDTAHNeQQKAGYQHQIDITLPRRKRCLEAIEVLEEYLSFKE 185 [Mannheimia] succiniciproducens M...
jgi:HSM_1492      136 ALQALNTKLERQRDCFEEATLlQDKQTYSQQIAITQQRKQRCSEAIEQLEEYLalld 192 Histophilus somni 2336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap