Conserved Protein Domain Family
Glyco_transf_56

?
pfam07429: Glyco_transf_56 
4-alpha-L-fucosyltransferase glycosyl transferase group 56
This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (EC 2.4.1.-) (approximately 360 residues long). This catalyzes the synthesis of Fuc4NAc-ManNAcA-GlcNAc-PP-Und (lipid III) as part of the biosynthetic pathway of enterobacterial common antigen (ECA), a polysaccharide comprised of the trisaccharide repeat unit Fuc4NAc-ManNAcA-GlcNAc.
Statistics
?
PSSM-Id: 400007
View PSSM: pfam07429
Aligned: 16 rows
Threshold Bit Score: 576.554
Threshold Setting Gi: 219691456
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCH:MU9_246       1 MTTLIHVLGSDIPHHNQTVLRFFNDVLAPQLPREEMPEFMVVSTAGQLLAQYPNLELDVWPDKKSLANAVTAKAKRDRQC 80  Morganella m...
ACR67359          1 MTTLIHVLGADIPHHNLTLLRFFDGVLSQRAATAPRRRFMVVARDAAPFAALTTLDIEVWPDKRALARALLARARADRTL 80  Edwardsiella...
ACL32679         35 MANIIHVLGANIPHHNHTILNFFQNELLDELPNA--FHFYVVSRSD-LSETFTLLDINSYPDEYLLTQEVIKIARKEPTA 111 Glaesserella...
Q7VKN8            5 MNPIYHLLSSDIPQHNQSVLDFFQSQLLPVLADQQ-HIFYVVNQTR-LQEQYPALKLHCFNSKGAIAKAVLQVAKKEPNA 82  [Haemophilus...
Q2NQC4            1 MSNLIHVLGSDIPHHNVTVLRFFNDTLAAICPPAQTRRFMVVARDNAPFSHCGQLDIERFDSKRALTKALIRGAAAAPDE 80  Sodalis glos...
WP_013319851      1 MTTLIHVLGADIPHHNQTVLRFFNDTLAPSLPSHQVRRFMVVSAAELSGHAYPALQIARFADQKALARAVVVQAREDRSV 80  Dickeya dada...
BAN96834          1 ------MLGSDIPHHNHTLLRFFNDVMSVESPADAPRQFMVVSAAPDTLLAYPQLQIDVYPSKRALAQAVIARA-ADRRQ 73  Plautia stal...
WP_013200241      1 MTTLIHVLGSAIPHHNQTVLRFFNDSVADAVPRAEPRQFWVVGEPAA--TDYSRLAIRWFANKRAIADAVVALAQADRQT 78  Erwinia bill...
wugsc:KPN_04293   1 MTALIHVLGSDIPHHNQTVLRFFNDELAA---DPQARRFMIVGDEASVRDGYPALDITCYPGKKALAQAVIATAKANRQQ 77  Klebsiella p...
WP_002444169      1 MTKLLHILGSDIPHHNQTVLRFFNDKLAAE--TTLAHRFMVVAGAGFTPEAYPALDITVYPGKSALAKALVAFARQHPDD 78  Shimwellia b...
CCH:MU9_246      81 RFFFHGQFNALIWLALLSGKIKRHQFYWHIWGADLYEDSRQLKFRLFYHLRRLAQKRVGHVFGTRGDLNYFAQ--FCPKI 158 Morganella m...
ACR67359         81 RFFLHGQFNPWLWLALLCGRLRPQQVLWHVWGADLYEEARGWKYRLYYGLRRLAQGRVGHVFATQGDLDYYRQ--RHPRV 158 Edwardsiella...
ACL32679        112 WFVLHGQFNTSLWLAILLGLVPANRCVWHIWGADLYELSSSLKFRLFYPLRRLAQRKIARLWGTLGDLNHAYQqlKRKSS 191 Glaesserella...
Q7VKN8           83 QFILHGQYNVWLWCAILVGKLPAYRCYWHIWGADLYQASTDWRFKLFYPLRRLAQQKFTHIWATRGDLAYVAQhlARQKR 162 [Haemophilus...
Q2NQC4           81 RYFLHGQFNPSLWLAMLTGKIRPARLSWHVWGADLYEDSRRLRHRWFYLLRRRAQGRVGHVLATRGDLACYRQ--RHPSV 158 Sodalis glos...
WP_013319851     81 RFFFHGQFNPWLWLALLCGGIRTTQAYWHIWGADLYEEARGWRYRWFYRLRRLAQRRVARVFATCGDIDYFRR--RYPAA 158 Dickeya dada...
BAN96834         74 RFFFHGQFNPRLWLALLSGKLRRQQAFWHVWGADLYEEGAGLKYRLFYLLRRIAQGRMAQVFATRGDLHFFQQ--RHPRV 151 Plautia stal...
WP_013200241     79 HFFFHGQFNPTLWLAILFGKIKPAQVYWHIWGADLYEQAGGLKFRLFYFLRRLAQKRVGQVFATRGDINYFQQ--RYPDV 156 Erwinia bill...
wugsc:KPN_04293  78 RFFFHGQFNTGLWLALLSGGIRPSQFNWHIWGADLYENSASLKFRLFYPLRRMAQGRVGRVFATRGDLSWFAN--RHPRV 155 Klebsiella p...
WP_002444169     79 GLFFHGQFNTGVWLALLRGGLKPARVSWHIWGADLYEVSSSLKFRLFYLIRRIAQGRVGRVFATRGDLDYYHQ--RHPVV 156 Shimwellia b...
CCH:MU9_246     159 PADLLYFPTRMDPSLTVLTPPEPRGDDnMMILLGNSGDRSNRHKEALTRIHEQF-GEKVKIIIPMGYPENNGDYIAEVDA 237 Morganella m...
ACR67359        159 ATSTLYFPTRMDPALTCNQRVRETSGA-LTVLVGNSGDRSNRHLVALQRLHDTF-GPQTRVIVPLGYPANNQAYIAQVRE 236 Edwardsiella...
ACL32679        192 LDQRLYFPTRMPTNFPTKKCSYQR-----TILLGNSGDPSNQHLLGLKQIREIF-GENVRIVVPMGYPAGNSKYIAQVRQ 265 Glaesserella...
Q7VKN8          163 DDRLVYFPTKMRSARWLAPPKEHNAATkITILLGNSGDPANQHLTALTHIKQSLsAQSVKIIIPMGYPAHNQRYIQQVKQ 242 [Haemophilus...
Q2NQC4          159 PASLLYFPTRLATDIARATPDKADNRP-LTLLVGNSGDASNRHSQALRAIHHHF-GTGVSIIVPMGYPAGNDAYIATVRA 236 Sodalis glos...
WP_013319851    159 ATSLLYFPTRMSPHAASPHEKAPDAP--LSILVGNSGDPSNRHLAALDAIHRQF-GAQAQVIVPMGYPAGNHAYIEQVAQ 235 Dickeya dada...
BAN96834        152 PTSLLYFPTRMPEAAIPAPAASDS----FTILLGNSGDRSNRHIEGLQAIRRQF-GEQVNVVIPLGYPASNYEYIDEIDA 226 Plautia stal...
WP_013200241    157 PAALLYFPTRMAQVALPAAEPQPE----MTLLVGNSGDESNRHIQALQEIHQQF-GRQVNVVVPMGYPEHNDAYIQRVRE 231 Erwinia bill...
wugsc:KPN_04293 156 PGELLYFPTRMDPALNTLADNDPRGDT-LTILVGNSGDRSNEHIAALKAIHQQF-GDTVNVIVPMGYPAKNDAYINEVRE 233 Klebsiella p...
WP_002444169    157 PGQLLYFPTRMDPQLNTLADSITRQGP-LTILVGNSGDRSNNHIAALQAVHRQF-GDTVNVVVPMGYPANNQAYIDEVEQ 234 Shimwellia b...
CCH:MU9_246     238 FAQQLFPqQQAEILKDKMDFDIYLNLLKQCDLGYFIFNRQQGIGTLCLLIQFGIPFVISRQNPFWQDMTEQQVPVLFYGD 317 Morganella m...
ACR67359        237 RAESLFG-HNATLLTQQVAFTDYLALLARCDLGYFIFERQQGIGTLCLLLQQGIPPVLSRQNPFWRDMAAQQLPVLFDDD 315 Edwardsiella...
ACL32679        266 QAEQDFQqGQVNILTQKLEFESYLDLLSQCDLGYFPFERQQGIGTMCLLIQMNIPIAIHRANPFQQDLQAEGISFLFA-D 344 Glaesserella...
Q7VKN8          243 QAERLFPvNTVQILTEKLSFTDYLALLQQCDLGYFNFTRQQGIGTLCLLIQLGIPCVLHRQNPFTLDMDYEQIPFLYH-D 321 [Haemophilus...
Q2NQC4          237 QAERCFPaGQVQILTEQLAFDDYLALLRQCDAGYFLFPRQQGIGTLSLLIQLGLPFVLSRHNPFCQDLQAQQVPVLYEDD 316 Sodalis glos...
WP_013319851    236 HGLALFGaDRCRVLRESLAFDDYLALLRTCDLGYFLFHRQQGIGTLCLLIQLGVPFVISRHNPFRLDLVEQRLPVLLGEE 315 Dickeya dada...
BAN96834        227 AAQRLFPrGQVTLLRDRIDFTAYLQLLSRCQLGYFMFERQQGIGTLCLLIQAGIPFVVNRKNPFWRDLSEQGLPVLFSAD 306 Plautia stal...
WP_013200241    232 AGLALFApERLQILTEKLEFATYLQLISRCDLGYFIFERQQGIGTLCLLIQANVPFVVNRKNPFWQDLTEQQVPVLFAGD 311 Erwinia bill...
wugsc:KPN_04293 234 AGAALFSgEHLQILSEKLEFHDYLALLRRCDLGYFLFARQQGIGTLCLLIQAGIPCVLNRENPFWQDMAEQHVPVLFTSD 313 Klebsiella p...
WP_002444169    235 AGRGLFStGHLRVLREQMPFAEYLQLLRTCDLGWLTFERQQGIGTLCLLIQAGIPCVLSRKNPFWKDMVAEQLPVLFEGD 314 Shimwellia b...
CCH:MU9_246     318 DVTPDVVAQAREQLFALDREKIAFFSPNFVQGWEQALAA 356 Morganella morganii subsp. morganii KT
ACR67359        316 APDDVAVRAAQRQLALRDLSQIAFFDPNYIDGWLQALAL 354 Edwardsiella ictaluri 93-146
ACL32679        345 EISNSEIIRVKSQLALLDKSKITFFPLSYKQEWLNCLhs 383 Glaesserella parasuis SH0165
Q7VKN8          322 QLNVTAIRQTQRQLAKVDKQQIAFFAPNYAKQWISLLTE 360 [Haemophilus] ducreyi
Q2NQC4          317 ALDAAMIREAQRRMLALDPARIDFFYPNILQGWRQALSI 355 Sodalis glossinidius str. 'morsitans'
WP_013319851    316 TLNQAMVRDAREQLAHIDTRQIAFFSPGYEQGWRQALSL 354 Dickeya dadantii
BAN96834        307 ALDRTRVAEAQRQLAQCDRSAIAFFAPGYLAGWRHALAE 345 Plautia stali symbiont
WP_013200241    312 SLDAKVVGEAKRQMSLLDKPAIAFFEPAYLDGWKTALAQ 350 Erwinia billingiae
wugsc:KPN_04293 314 ALDVSVVREAQRQLASVDKSAIAFFRPNYLTGWQRALRL 352 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
WP_002444169    315 VLSEQIIRQAQRQLSCVDKQHIAFFNPGYLAGWHDALRL 353 Shimwellia blattae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap