Conserved Protein Domain Family
Pro-NT_NN

?
pfam07421: Pro-NT_NN 
Neurotensin/neuromedin N precursor
This family contains the precursor of bacterial neurotensin/neuromedin N (approximately 170 residues long). This the common precursor of two biologically active related peptides, neurotensin and neuromedin N. It undergoes tissue-specific processing leading to the formation in some tissues and cancer cell lines of large peptides ending with the neurotensin or neuromedin N sequence.
Statistics
?
PSSM-Id: 400002
View PSSM: pfam07421
Aligned: 9 rows
Threshold Bit Score: 204.647
Threshold Setting Gi: 1040669494
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9D3P9         6 LQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHTSKI---SKASPPSWKMTLLNVCSLINNVNSPAEEAGDMHDDDL 82  house mouse
NP_001232613   3 VQLVCVVLLALASCSLCSDSEEEMKALEADLLTNMYTSKI---NRAKLPYWKMTLLNVCNLVNNINNQMGETVEVDEEDL 79  zebra finch
XP_003771020   7 IPLVCMMFLAFTSQSLCSDSEEEMKALEADLLTNMYTSKI---NKARFPHWKMTLLNVCSLVNNLNSPAEETGETGEDEL 83  Tasmanian devil
P10673         7 IQLVCMILLAFSSWSLCSDSEEEMKALEADLLTNMHTSKI---SKASVSSWKMTLLNVCSFVNNLNSQAEETGEFREEEL 83  dog
XP_003221181   8 MQLACAMLLAFASWSLGSDSEEEMKALEADLLTNMYTSKV---NKAKLPPWQMTLLNICDLISNLNNQ-EETAGNTEDDL 83  green anole
XP_003449243   3 TQLACMLLLCLTCGALCTDVDQEQRALEEELLSSLFTSKMk-qNKQSAPYWRVSLANLCKMLSALRQ---EAWSGEEEDE 78  Nile tilapia
ALD51567       3 AQLACMLLLCFTCGGLCTDVDRDPQALEEELVRSLFPSKVakqNKQSAPYWRVSLVDLCRMLNGVSA---AELGGEGELE 79  three-spined st...
XP_017207567  13 mqltsflllfllcnglcSDIDQGKRAIEDEVLRSLLTSKVk-aSRHIAPLWQLPLQDVCRMVNGLGDSWLEAWANEEAAE 91  zebrafish
XP_006633673   4 qLICLVLLFA-ASDGMCSDSDQEMKMIEEELLNSLYTTKV---NKQRLPSWKLSLLNMCRLINDPSRQGDDVWTSDEEGF 79  spotted gar
Q9D3P9        83 VGKRKLP--LVLDGFSLEAMLT--IFQLQKICrsRAFQHWEI------IQEDILDNVNDKNEKEeVIKRKIPYILKRQL- 151 house mouse
NP_001232613  80 VPGRQFP--AALDGFSLEAMLT--VYQLQKVChsRAFQHWEL------LQQDALDLENSSQEKE-IMKRKNPYILKRQL- 147 zebra finch
XP_003771020  84 VMRRQL---STLEGFNLEAMLT--IYQLQKICrsRAFQHWEL------LQEDVLESGNLNREKEeIMKRKTPYILKRQL- 151 Tasmanian devil
P10673        84 ITRRKFP--TALDGFSLEAMLT--IYQLQKIChsRAFQQWEL------IQEDVLDAGNDKNEKEeVIKRKIPYILKRQL- 152 dog
XP_003221181  84 MTRR-----PTLDSFTLEAMLT--LYQLQKVChsRTFQQWEL------FQQDVYDPENSSQDKD-LMKRKTPYILKRQL- 148 green anole
XP_003449243  79 D--------GGLREGSLQLLDE--MYNLQRIC--RVLQSREEr-----LLQDSLEYSE--ENSDaPLKRKSPYILKRQAg 139 Nile tilapia
ALD51567      80 F--------NFVNSKTLHYLSAniIINLIYLN--KAPENRKEkyshcvILRGPQDYLE--GNRDnPLKRKSPYILKRQAa 147 three-spined st...
XP_017207567  92 DTEVHADyeQRVSGTLLQMLEE--MHDIQNLC--RVLQPRE--------LQDEQEYLELEQNSDsPLKRKSPYILKRQL- 158 zebrafish
XP_006633673  80 ISREQIS--TFPDSFSLEKLAD--FYQLQNLC--RILHGGE-------FNQKTEDYLDQDYKNEgPLKRKSPYILKRQL- 145 spotted gar
Q9D3P9       152 YENKPRRPYILKRGSyYY 169 house mouse
NP_001232613 148 HVNKARRPYILKRSS-YY 164 zebra finch
XP_003771020 152 HVNKARRPYILKRSSsYY 169 Tasmanian devil
P10673       153 YENKPRRPYILKRGSyYY 170 dog
XP_003221181 149 HVNKARRPYILKRSS-YY 165 green anole
XP_003449243 140 HITKTRRPYILKRST-FY 156 Nile tilapia
ALD51567     148 HTTKSRRPYILKRST-TY 164 three-spined stickleback
XP_017207567 159 RTNKSRRPYILKRSV-IY 175 zebrafish
XP_006633673 146 HINKPRRPYILKRST-LY 162 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap