Conserved Protein Domain Family
NICE-3

?
pfam07406: NICE-3 
NICE-3 protein
This family consists of several eukaryotic NICE-3 and related proteins. The gene coding for NICE-3 is part of the epidermal differentiation complex (EDC) which comprises a large number of genes that are of crucial importance for the maturation of the human epidermis. The function of NICE-3 is unknown.
Statistics
?
PSSM-Id: 399994
View PSSM: pfam07406
Aligned: 25 rows
Threshold Bit Score: 176.682
Threshold Setting Gi: 808354451
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001949034   3 QQLSGVTVVIFIAGGILTFILLFIFAKRQIMRFAlr-sRRGPHVPIGHDGKKTLKREIERRIEVVPKIAFEPKLMTIDqd 81  pea aphid
EKC29150       5 RELTIVGVVLFIAAGLLLFIMAFIVVKRQISRFA----TRGAQKSIGSGAPKMFKKQILEKLNRVSTIKYEPILLNNKvm 80  Pacific oyster
XP_001637825  18 KKFGGVGLVMTIVFTIAIGLMIVIIVKRQILRMIli-sRRGPHTSIGADAPRPLARQIENQLKRISHLRIEPRMMSEQfn 96  starlet sea ane...
XP_003141371   1 mvidGYSVLFLFTVGVLITIILAIFVQRQIFRMRdnsvRREANIVVGAGLSKRKKEELDRGIEIVRQFQ----LLR---- 72  eye worm
EFX67776       3 SDFSGATIVIFIALGSLVLVLLFIFAKRQIMRFTlr-sRRGPHVPIGHSAPRWLRKEIERRLDLVGRIKHEPKLVSEAss 81  common water flea
XP_001600008   3 QQLSGVNIVLFIAAGVQTVILLFIFAKRQIMRFTlr-sRRGPHTPIAYDTIKSLRKEIDRRIHVIPRIQYEPYL------ 75  jewel wasp
1_pfamImport   1 EKLSGVMVVIIIAGGVLTFILLFIFAKRQIMRFAlr-sRRGPHVPVGHGAKKALKKEIHRRIELVPKIVYEPRVSDESn- 78 
Q16XQ5        27 EELSGVMIVLIIGGGVLAVTICFIIAKRQIVRFTlr-qRRGPHVAVGHDAKKSIKKEIERRIDCIQKIYFEPKLLWDDkt 105 yellow fever mo...
EDW32322      28 EQLSGVMIIIIISGGVLTSLMLFIFAKRQIMRFQlr-gRRGPHVPVGNDAKKVLRREIERRLDCIQKIAQEPKLLWTDg- 105 Drosophila pers...
5_pfamImport   1 --WTGINLLLVLIYGFITVLLVAIFAKRMIHRVSlk-fSHSVEVE-GSGANKSLKLEIRTRMEEAINFAYEPTLLNPG-- 74 
XP_001949034  82 ddlSKYilpppesnnkpllSHHYRMKAVDDVKKL-EREITKQD-KTLTRHPSENIRSFLLNTL---AVLLDGSGQHIVHQ 156 pea aphid
EKC29150      81 sspDSS-------------HYLHRMKAMDAFSMF-DETIKTVDsNYKGRHPNTRVRWYLTGLS---KTYLCTCPLDLIND 143 Pacific oyster
XP_001637825  97 rpaDESsfdspp--dqysrSYKYRMKAMDKMGEL-DDLICSVS-HKYNRRKGQPVRSYLKMLQ---QQQVIKKGDDTIDK 169 starlet sea ane...
XP_003141371  73 ---APKfteigtiaehagaPYINRMIAMDELREI-ERQLEFIN-GDLGRVAGESMYAYLSRIR---QIALPSLSEHLCER 144 eye worm
EFX67776      82 ad-------------thnpETLCRMQAMDDIKIL-EIQLQAAD-PKAGRMPNENLRPFLMAQI---PGILKGCHPKTIHQ 143 common water flea
XP_001600008  76 ---DESihklmn--egpipSHFYRLKAVNDFKKLgELQINHQN-NFFKRHPKENIRGYLINAL---SDNLTGNGQHMIHE 146 jewel wasp
1_pfamImport  79 ---SKYilppg----ssvpPFYYRLKACDDVKLL-EKEICRQDiTSAGRHPSESLRAYLLNNL---ASPLGGPGSRLIHQ 147
Q16XQ5       106 -dgKKYilqpd----snlpPFYYRMKAMDDVKEL-EKEIAKQD--GSTRHPRDSLRAFLLTTL---AAPLNGSGQRLIHQ 174 yellow fever mo...
EDW32322     106 ---DKYivppeq--eeplpPYYYRMKAVDDVKLL-ESEIARAD--GSSRHAHESLRAFLLTTL---SIPLTGAGQRMIHQ 174 Drosophila pers...
5_pfamImport  75 ---DDRlnmdv---kpghfYFVNRMKTVDGFRNI-DQVLGDLN-KDLYRPKGKNVRQHLFDAKshsSGCLRAVRTNQLQA 146
XP_001949034 157 FCDLYEHARYDPNEFLDEEYQSFIRLMKKLID 188 pea aphid
EKC29150     144 FCDAYEHARHSPEMFGENEYNNYMKLLTRLLD 175 Pacific oyster
XP_001637825 170 LADMYEHARFEPKEFGNIQYKKFAYLVEQLKD 201 starlet sea anemone
XP_003141371 145 IGLVAEHCRYRHEPFGESELTETRMLIKEIVk 176 eye worm
EFX67776     144 LCDLYERARFSPDGFTSNHLETYRELVASLVr 175 common water flea
XP_001600008 147 FCDLYEHARHDPSEFQDEEYEIYSKLLLKLID 178 jewel wasp
1_pfamImport 148 FCDLYEHARHDPADFADDEYHVYSRILLKLID 179
Q16XQ5       175 FCDMYEHARHDPNEFGEEEYQSYQRLLKKLTD 206 yellow fever mosquito
EDW32322     175 YCDMYEHARHDPNEFGKDEYEAYHHLLLKLME 206 Drosophila persimilis
5_pfamImport 147 LADFYLQARFGTEPYHFEDHLKFL-------- 170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap