Conserved Protein Domain Family
Lenti_VIF_2

?
pfam07401: Lenti_VIF_2 
Bovine Lentivirus VIF protein
This family consists of several Lentivirus viral infectivity factor (VIF) proteins. VIF is known to be essential for ability of cell-free virus preparation to infect cells. Members of this family are specific to Bovine immunodeficiency virus (BIV) and Jembrana disease virus which also infects cattle.
Statistics
?
PSSM-Id: 116023
View PSSM: pfam07401
Aligned: 2 rows
Threshold Bit Score: 362.391
Threshold Setting Gi: 82294409
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19563   1 MERTLQSVVGRRRGSSNRGRGKNSLISTPSYALHPPPRFRYPRWEFVRQTEYSMTACVRKGKLVLTYQYAIWKRVWTIET 80  Bovine immunodeficien...
Q82852   1 MERTIQSPMGRRRGSSGRRKRNANIISPPAYAIYPAPQYRYPRWEFVMNDLYSQTARLQKEEIIITYRYAVWAREWKIQT 80  Jembrana disease virus
P19563  81 GFTDPSLFMTPAGTHTTEEIGHLDLFWLRYCSCPHEMPPWLDFLRGTLNlRISCRRALQASVLTSTPRHSLQRLAALQLC 160 Bovine immunodeficien...
Q82852  81 GFLDLGYLMTPAGTHTTGELNELDLFWVRYTLCQHRSPKWRELLLGEMT-HTSCRRTAQAAVVSHTKPHTLQRLAGLTLV 159 Jembrana disease virus
P19563 161 TNACLCWYPLGRINDTTPLWLNFSSGKEPTIQQLSGHP 198 Bovine immunodeficiency virus R29
Q82852 160 CNQNLCWYPVGTVTRNSPLWMHFTTGKEPTIQQLSGHP 197 Jembrana disease virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap