4MHL


Conserved Protein Domain Family
IL11

?
pfam07400: IL11 
Interleukin 11
This family contains interleukin 11 (approximately 200 residues long). This is a secreted protein that stimulates megakaryocytopoiesis, resulting in increased production of platelets, as well as activating osteoclasts, inhibiting epithelial cell proliferation and apoptosis, and inhibiting macrophage mediator production. These functions may be particularly important in mediating the hematopoietic, osseous and mucosal protective effects of interleukin 11. Family members seem to be restricted to mammals.
Statistics
?
PSSM-Id: 399993
View PSSM: pfam07400
Aligned: 11 rows
Threshold Bit Score: 162.176
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MHL_A        13 PRAELDSTVLLTRSLLADTRQL--AAQLRDKFPADGD-HNLDSLPTLAMS-AGALGALQLPGVLTRLRADLLSYLRHVQW 88 
KFO36483      63 ARAEMDSTVLLTRSLLLDTQEL--FAQLKNQYPVAGG-FGLKSLPKLAMS-AGALGALQLSSMLTRLRTDLLSYLRHMQW 138 Damara mole-rat
2_pfamImport   6 vDHELDTMVNLAKNILHDTKIA--FRQFKLKFPSEGE-HRLETLPVLSGS-ASDLGAIQVTNALSKIDSDLRSYEEHFEW 81 
XP_003966297  33 rPSDMDRLSNQTKHLMKLTQEL--LREHS--FDSDVEpHRFTSLPEMSNRsAHSLNNLELKPTLSQLHADLKLYEHHFEW 108 torafugu
XP_007241275  37 SHADLDKLTNQTRHLQKLTHDL--INDHE--LDSVIDhHRFKSLPAINGR-ANDLSSLELKTTLSQLHTDLKSFEHHFEW 111 Mexican tetra
KPP75226      32 rQIAEAEITNQTRHLLKLTQEL--LKDHV--IGTDIE-HRFKTLPAMANR-VADLSTLEVKSTLAQLHSDIQLFDLHFEW 105 Asian bonytongue
XP_021323960  20 GKKHLSTLYQDMRMLLKLTSQQ--MNANE---LTDFE-HSLSSLPSLNYS-VKDLHSLEVSSTLAQLYSGLKSFKFHLDW 92  zebrafish
3_pfamImport   7 LCGMFRPMVLQLNSLNNMSKKLhhLTDHELVIFEGVE-HRLDDLPHIQHT-AAHFSSLKVNESLSQLLRYTRSFRLHVDW 84 
XP_698974     34 NQIDFDKLSNQTKLLLTLTRNL--LKDRV--FSTEINhHRFKSLPAISSR-ASDFATLEVKPTLSQLHANLKSFQHHFEW 108 zebrafish
EHB13455      35 PRAELDSAVLLTRSLLVDTRQL--AAQLRDKFPVDGD-HSLDSLPTLAMS-ASALGALQLPSVLTRLRTDLLSYLRHVQW 110 naked mole-rat
XP_018081759  26 PKVEFDDLLNMAMHLLRDTKQS--YHNFKAKYPSEGE-HKLDSLPVVSMN-AVEISNVQIHTSLLKLSTDLFIYQKHFDW 101 African clawed ...
4MHL_A        89 LRRAGGS--SLKTLEPELGTlQARLDRLLRRLQLLMSRLALPQPPPD-PPAPPLAPPSSAWGGIRAAHAILGGLHLTLDW 165
KFO36483     139 LRRVGGP--SVKSLEPELGT-LQTQLDRLLRRLQLLMASLALPQVPPeLPAPPLPSSLKDWRSIQAAHAIIGGLHLTLDW 215 Damara mole-rat
2_pfamImport  82 LKKAEVI--SKAPLEQSITK-IHSKTQNLANHIEHLMNRHNIPKSNF-SPPQLPPQHATHWSAVHAGHAIFHHFKLFMDW 157
XP_003966297 109 LNRVSKK--HHHPALPKLVE-MIKEMKSLITLLHCQMLRVEAPRLTP-ATPSLPPHLPYQFDVLQSSHELLQHFKLFCDW 184 torafugu
XP_007241275 112 LNKVTKK--HQHSTAPKLGE-MISHIKSLINSLQRQMSRVDAQRNPV-PSPSLPPHPTSHWEMDQSSQELLQRFRLYCDW 187 Mexican tetra
KPP75226     106 LNKALKN--RKHASFPKLGE-LIQHLKLLKFSLQRQMTKLQVLRPPT-PSPSLPSTDVNEWEVVQSSLELFQKFRLFCDW 181 Asian bonytongue
XP_021323960  93 VQRNSDElgNDYSKTKKIVH-LIQAI------IQKVLQELGQTAPEI-VHPTLPPL-ETFWQLYQTNAEIHKKLLIFCDY 163 zebrafish
3_pfamImport  85 LKTAKEN--VSLSS-RSTGG-AGAHLLRLSDLLTASLLQMGEEVPPS-LSPPLAPI-STAFDVLRFSVEMSERLMVFCNW 158
XP_698974    109 LNNITHK--QQHSI-PKLTD-MVSHIGGLVNSLQRQMNHIGAPRLTV-PSPSLPPIPAFHWEMVQTSQELLEQFSLFCDW 183 zebrafish
EHB13455     111 LRRVGGP--SLRTLEPELGT-LQARLDRLLRRLQLLMSVLALPQVPPePPTPPLAPPASAWGGIRAAHAVLGGLHLTLDW 187 naked mole-rat
XP_018081759 102 LRKAAH---AIRPMDHEFNG-IHNRIEKLLKKIDLLMIRHHMPRVTEpVAPQL-SNSTTPWGVIQSGHAIFRHFHLFLDY 176 African clawed ...
4MHL_A       166 AVRGLLLLKTRL 177
KFO36483     216 AVRGLMLQKAQL 227 Damara mole-rat
2_pfamImport 158 TVRALVVLQNKH 169
XP_003966297 185 AYRAFLSLKPKV 196 torafugu
XP_007241275 188 ATRAFLSLKSKT 199 Mexican tetra
KPP75226     182 ALRVFLSLKLRH 193 Asian bonytongue
XP_021323960 164 YTRALGSLKRKH 175 zebrafish
3_pfamImport 159 SKRVLLRLQRLC 170
XP_698974    184 AARVLGRTRSLL 195 zebrafish
EHB13455     188 AVRGLLLLKTRL 199 naked mole-rat
XP_018081759 177 ATRVLVLMKNKl 188 African clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap