Conserved Protein Domain Family
FlbT

?
pfam07378: FlbT 
Flagellar protein FlbT
This family consists of several FlbT proteins. FlbT is a post-transcriptional regulator of flagellin. FlbT is associated with the 5' untranslated region (UTR) of fljK (25 kDa flagellin) mRNA and that this association requires a predicted loop structure in the transcript. Mutations within this loop abolish FlbT association and result in increased mRNA stability. It is therefore thought that FlbT promotes the degradation of flagellin mRNA by associating with the 5' UTR.
Statistics
?
PSSM-Id: 399983
View PSSM: pfam07378
Aligned: 58 rows
Threshold Bit Score: 110.681
Threshold Setting Gi: 81562851
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015828163               3 LKLSLKPQEKFVVNGAVLQNgDRRCVMLLQNK-ASVLREKDIMQPDDVTTPAKHIYFPVMMMYLDGGTPRgQQYEEFVLR 81  Hir...
WP_007423973               4 LVLELRQGDIMILNGAPIRF-RTKSRIELTAK-ARFMFGKQILRPDEVNTPAKQIYFALQTAYIGTDEERqSALVRAREL 81  Aci...
PRJNA212980:JCM7686_2168   4 LILRLAPMERFLINGAVIENgAKRTQISIRSPdARILRLRDAIHPRDVRGVLSEACYTVQLVLTGDYEYL-AAFEKIMNA 82  Par...
Q3HKK9                     4 LVLRLGPGERVMINGAVIENgDRRSRITVMTPnSVILRQRDAIRPEEANTPVRRICYMAQLVLSGDATFE-DMKPQLLRG 82  Rho...
Q28JJ4                     4 LVLKLGPKERVLVNGAVIENgDRRTRLSIVTPdANILRLRDAIHPDEANTPVRRVCYIAQLVLSGDVDYE-DAKTQLLRG 82  Jan...
WP_014876468               4 LVLKLAPKERVLVNGAVIENgDRRSRLSIVTPdANILRLRDAIHPEEANTPVRRVCYAAQLVLSGDVDGE-EDRLQMLRR 82  Pha...
Q5LMV5                     4 LVLKLAPKERVLINGAVIENgDRRGRLSIMTPdANILRLRDAIHPEEATTPVRRVCYAAQLVLSGDSDPD-QAKMSLLRR 82  Rue...
rhodo:RCAP_rcc03523        4 LVLKLAPKERVLINGAVIENgDRRSRLAIMTPnAHILRLRDAIHPEEVNTPVRRVCYIAQLVLSGDADSS-EARMQLLRG 82  Rho...
jgi:Dshi_3359              4 LVLKLAPKERVLVNGAVVENgDRRSRLSIITPnANILRLRDAIHPDEVTTPVRRVCYIVQLILSGDMCPD-ESSMQVLRG 82  Din...
ADO43487                   4 LVLKLAPHERVLINGAVIENgDKRSRLSVVSPkANILRLRDAIAPDQATTPVRRVCYIAQLLLTGDCDRA-EGRRQLLHG 82  Ket...
WP_015828163              82 ITEFMNAISNADILKECVSLSRDVMGGDYYKALGRCRKLIAYEEEIL 128 Hirschia baltica
WP_007423973              82 IEQFKEATTSALAREILDRALECAKSDDCYEALKLSRRIMRHEAAVL 128 Acidiphilium
PRJNA212980:JCM7686_2168  83 IIYAQTLVKDQNSDMKLQKMQLAWVTKDVYPVLKGLKYFLELEKTIn 129 Paracoccus aminophilus JCM 7686
Q3HKK9                    83 IEQLSQVLTDPDSRAQLGVATEAVLAGHHYQILKALRSLLPREARLF 129 Rhodobacter sphaeroides 2.4.1
Q28JJ4                    83 MEQLSQVFTDTDSRSLLSQATESLVDGQVYQTLKSLRGLLAREERMI 129 Jannaschia sp. CCS1
WP_014876468              83 IEELSQVFTDPDSRASLAEATDAVLSDNHYRCLKALRTLLPREDRLM 129 Phaeobacter
Q5LMV5                    83 IEELSQVFTDPDSRKALAQATEALVADHPYKCLKALRTLLPREERIL 129 Ruegeria pomeroyi
rhodo:RCAP_rcc03523       83 IEQLSQVLTDHDSRAHLTQATAAVLEDQHYQALKSLRALLPREERLL 129 Rhodobacter capsulatus SB 1003
jgi:Dshi_3359             83 LEQLSQVFRDDDSRARLADATNAVLAKNHYQALKSLRCLLPREERLM 129 Dinoroseobacter shibae DFL 12 = DSM ...
ADO43487                  83 IEQLSQALVDPDSRRQLADATAASITEDYYRALRRLRALLPREERLL 129 Ketogulonicigenium vulgare Y25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap