5Y2G,6JLC


Conserved Protein Domain Family
CAMP_factor

?
pfam07373: CAMP_factor 
CAMP factor (Cfa)
This family consists of several bacterial CAMP factor (Cfa) proteins which seem to be specific to Streptococcus species. The CAMP reaction is a synergistic lysis of erythrocytes by the interaction of an extracellular protein (CAMP factor) produced by some streptococcal species with the Staphylococcus aureus sphingomyelinase C (beta-toxin).
Statistics
?
PSSM-Id: 399981
View PSSM: pfam07373
Aligned: 11 rows
Threshold Bit Score: 260.795
Threshold Setting Gi: 81611671
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y2G_A                   368 NAVDSNNQAQQMAQKLDQDSIQL-----RNI-KDNVQGTDYEKPVNEAITSVEKLKTSLRA---NSETVYDLNSIGSRVE 438
bcmhgsc:HMPREF0573_10472 126 STELTPSEAQSAIDDINAAVETL-----KEI-QSEEPKADWSKEFDKLFATATELTQSLAVvagGYQTLANPDLIMARTH 199 Mob...
jgi:Arch_0322             50 aAPIGKTEAKEKAADVDTVIAEI-----KEIgATSRPDIKWGKEFEGLFKTLYELKDELIAistGNVPAFDTTTILSRAK 124 Arc...
Q6A8G8                    35 aVSSNTADAHKLLEGVNGRITSLnd--dLKVaKASLSPMEVIDTIADLLKQAKQLKAQLEKivkGVVTF--AKSIPARVE 110 Cut...
Q6A826                    43 NKTLSVAEAQKELQVVNARIASLld--tQKSaKKAFAPANVLNIIGKLLETARRIKEALVNvikGGIAF--LKSIPTRVE 118 Cut...
Q6A9X2                    40 THELSASDARNSIQLLNAHIATL-----QSV-QKSVPGSDYSDQIRDLLKAAFDLRGLIETlahGGIPFYDPSTIMPRIK 113 Cut...
Q6A8D5                    41 KTALTTDQIKAERSALNSRINML-----QET-QKAIPGSQYADQIEDLIKTALDLSGAIDTiahGGVPAYDPATIVPRIH 114 Cut...
Q8CX01                    39 NHVNSNNQAQQMAQKLDQDSIQL-----RNI-KDNVQGTDYEKTVNEAITSVEKLKTSLRA---NPETVYDLNSIGSRVE 109 Str...
Q99ZD8                    40 NNNQANFQRDALVQKLDEGHQQL-----EAI-KHEAKGTDIETTVNKAIDAVDHMKSSIRF---NTETIYDFSSIGARVE 110 Str...
Q6A5Z8                    36 ARQHAQVDAEQALAQVNARIAELhkmpqAQVpASEAPKVNYGEEIRKLLDTAFELRTAIESiiaGKVPPVDLSTIPARVD 115 Cut...
6JLC_A                     3 STELTPSEAQSAIDDINAAVETL-----KEI-QSEEPKADWSKEFDKLFATATELTQSLAVvagGYQTLANPDLIMARTH 76 
5Y2G_A                   439 ALTDVIEAITFSTQHLANKVSQANIDMGFGITKLVIRILDPFASVDSIKAQVNDVKALEQKVLTYPDLKPTDRATIYTKS 518
bcmhgsc:HMPREF0573_10472 200 LIVEIGLTVDKSANNLRYKIQKAHVELGFSVTRAIMRVANIGATVYQLNDSISDLRATYERVSTYRDLKSTDTATIYVKD 279 Mob...
jgi:Arch_0322            125 LAAKIGQAINTGATTLRDKVQAAHVKIGFAVTRSIIRLTNLSSTEAQLNESTEELGNILTEVADYPDLTPEDNATIYVRN 204 Arc...
Q6A8G8                   111 LFLAMCDTTHTATLTLQDKVQNAHSTVFLAIAHAINVLITINSTPAQLTDEVAALKKAIAAAQAMPDLKPTDVATKYVRA 190 Cut...
Q6A826                   119 LLVTMVDTVNGAAHTLQDKAQPAHSHVFLELVHASVLLVTVSATSDQLKDEMAAVKKALAEAQKMPDLKPNDVATFYTKT 198 Cut...
Q6A9X2                   114 LVATTIDTIHTATTTLQNKVRPAHVELGLEVTKAVLLTANPASTAKELDAEGAALKARLEKVSQYPDLTPNDVATVYVRT 193 Cut...
Q6A8D5                   115 LAIDAADAIKTGNTTLQHKVKKAHVELGLEIAKASIVAINPASSVAQVQDEIKALKARIDKVSAYPDLSKDDTATIAYKQ 194 Cut...
Q8CX01                   110 ALTDVIEAITFSTQHLANKVSQANIDMGFGITKLVIRILDPFASVDSIKAQVNDVKALEQKVLTYPDLKPTDRATIYTKS 189 Str...
Q99ZD8                   111 ALSDAIKAIVFSTTQLTHKVEKAHTDMGFAITKLVIRIIDPFASVDAIKAQVQEIKALEEKVINYPDLQPTDRATIYTKA 190 Str...
Q6A5Z8                   116 LLTTSVKTIQQANHNLVNKVEAAHVELGFSITRALIRTINPTSTAAQLAESKADVLSTYAKVAAYRDLKPTDAATVYVKN 195 Cut...
6JLC_A                    77 LIVEIGLTVDKSANNLRYKIQKAHVELGFSVTRAIMRVANIGATVYQLNDSISDLRATYERVSTYRDLKSTDTATIYVKD 156
5Y2G_A                   519 KLDKEIWNTRFTRDKKVLNvKEFKVYNTLNKAITHAVGVQLNPNVTVQQVDQEIVTLQAALQTAL 583
bcmhgsc:HMPREF0573_10472 280 LLNKAIWNTRVARDKEILThKNFRTYQTLNKEITKAVRVWFKAKATVAECDAAIAKLNTAYATAY 344 Mobiluncus curtisi...
jgi:Arch_0322            205 ELTQKIWKTRWNRDTNILRkKSFATYNKLNRNITKAVGIELGPRSTVKQVREAVTALDNAYKEAL 269 Arcanobacterium ha...
Q6A8G8                   191 KLGRLMVQVRFDRNTCVINyKDRDAVRLLNRAIIRAGQVRSNAWVRVADVDQAIKELKAAYQDAL 255 Cutibacterium acnes
Q6A826                   199 KLSRVLRQIRFDRNTCVLPfKRLGTIYFMSRALLKATGVLMEPLVRVSEVDQAITDVKAAYQDAL 263 Cutibacterium acnes
Q6A9X2                   194 NFSKTIWQVRANRDRYILGhKSAAVYKTLNHAITKAVGVRLNPKTTVGNIQAARTELLAAYQTAF 258 Cutibacterium acnes
Q6A8D5                   195 TLRKTIHEVRVGRNKNIVGkKDQAVVDTLNKEISKADKVRANAKSTVAQVDTAVDQLRAAYQTAL 259 Cutibacterium acnes
Q8CX01                   190 KLDKEIWNTRFTRDKKVLNvKEFKVYNTLNKAITHAVGVQLNPNVTVQQVDQEIVTLQAALQTAL 254 Streptococcus agal...
Q99ZD8                   191 KLNKAIWNTRLERDKKVLGiKPFDVYNRLNKAITHAVGVQLNPTTTVQQVDDEVIAVQDALETAL 255 Streptococcus pyog...
Q6A5Z8                   196 RLNTKIWQTRINRDKYLLG-KNAEGYKAINKALTHATGVWFNPATTVKQVDDEVKALDLAFQAAL 259 Cutibacterium acnes
6JLC_A                   157 LLNKAIWNTRVARDKEILThKNFRTYQTLNKEITKAVRVWFKAKATVAECDAAIAKLNTAYATAY 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap