Conserved Protein Domain Family
DRAT

?
pfam07357: DRAT 
Dinitrogenase reductase ADP-ribosyltransferase (DRAT)
This family consists of several bacterial dinitrogenase reductase ADP-ribosyltransferase (DRAT) proteins. Members of this family seem to be specific to Rhodospirillum, Rhodobacter and Azospirillum species. Dinitrogenase reductase ADP-ribosyl transferase (DRAT) carries out the transfer of the ADP-ribose from NAD to the Arg-101 residue of one subunit of the dinitrogenase reductase homodimer, resulting in inactivation of that enzyme. Dinitrogenase reductase-activating glycohydrolase (DRAG) removes the ADP-ribose group attached to dinitrogenase reductase, thus restoring nitrogenase activity. The DRAT-DRAG system negatively regulates nitrogenase activity in response to exogenous NH4+ or energy limitation in the form of a shift to darkness or to anaerobic conditions.
Statistics
?
PSSM-Id: 369330
View PSSM: pfam07357
Aligned: 41 rows
Threshold Bit Score: 364.185
Threshold Setting Gi: 312939402
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2RUK5        39 TNRIGLSTDLIGSAAFNDDPLPLPIAGVREMNAGLFEMLAQAEGRADAADAFLKYMVAAFDI-DAEQHAapiGPDggrdg 117 Rhodospirillum ...
Q607D2        23 TNLVGIPTELLASPDFNQHPLPLRIHGTREAHSGLFARLGRCENLREAGGVFQDYMSVVFGF-EEEQRL---GEDrq--g 96  Methylococcus c...
WP_013820346  11 TNLIGIATACMASPLFNDNPQALHIAGTREAAAGLFEKLAQQHNVVDCGQVFQDYMCVVFGF-EAEQRL---GEDkq--g 84  Methylomonas me...
Q6N9V5        20 TNMVGVPVGLIGSTAFNRCLRRITIHGTRETHPGLFRLLAACEYPATASEVFEHYMELEFGL----------APGahept 89  Rhodopseudomona...
WP_014430471  17 TNLVGIPAPVLASLAFNAHPQPLRIAGARETQPGLFALLGRCPDAEQAREVFQHYMSLGFGLgAPAADAge-aER----- 90  Rubrivivax gela...
EHR69905      13 TNLVGVPGPVLAAVSFNAHPVPLSIAGARAVHGGLFALLARAEDMAQAREMFGHYMSLSFGL-APDEGArsaTER----- 86  Burkholderiales...
BAL23132      13 TNLVGIPTGLLASVAFNAHPLPLRIHGVRETNRALFAMLHDAASIEDAVLAFQIYMRSVFDL-DAAPLLdtlGRK----- 86  Azoarcus sp. KH32C
Q21AY8        17 TNLVGVPMDFLAHARFNDHPVPLHIAGVREMNPELFEMLAQASDLADAGGAFMCYMMAMFGI-DAEQQEtpaGPDk---- 91  Rhodopseudomona...
Q6N757        32 SNLVGVPMRFLTGVGFNDAPVPLHIAGVREMNPSLFEMLGQARDLAEAGEAFACYMTALFGI-DAEQRVr--GRDg---- 104 Rhodopseudomona...
WP_013068716  16 TNLVGRPSAWMASPGFNDAPVALHIWGVREMNPALFTMLDQAETLAEAGEAFLAYMVAMFGI-DPEQRDaapGSR----- 89  Rhodobacter cap...
Q2RUK5       118 tRPFRSSFLRLLIGWGWESNGPEGAVLKGWVESRFGLFPTFHKAKLTEGAEDAWAAYVEEAMASAFHTNAILTQLDLLYE 197 Rhodospirillum ...
Q607D2        97 rRRFRGSYLRLLQDWGFDSNNPQGAVLKGWVESRFGLFPTFHKQPLTGFATPAWMDYVDEKMASRFHNNCIYLQLDLLFE 176 Methylococcus c...
WP_013820346  85 qRRFRSSYLRLIQDWGLDSNNAQGAVFKGWVESRFGLFPNFHKQPLNSFMDKNWLVYIEEKMNSRYHNNCIFMQLDLLYE 164 Methylomonas me...
Q6N9V5        90 qARYPTSYLDLLRGWGVESDCPKAAVLKGWVESRFGLVPTFHKQRLGLFPSSAWATYLQEKTDVRFHNNCIFQQFDLLYE 169 Rhodopseudomona...
WP_014430471  91 -HRWRTSYLKLMQGWVLDSNSAAGAVLKGWAESRFGLVPTYHREALARYPSPAWMRYLEEKAGSRFHNNCIWQQLDLVFE 169 Rubrivivax gela...
EHR69905      87 -RRWRTSYRKLLQGWGLDANGAAGAVFKGWVESRFGLAPWFHKAPLVRFPSPAWVGYMEEKASARWNNNSIWQQLDLLYE 165 Burkholderiales...
BAL23132      87 --RYRANYLRLLRGWGFDANGREAAVLKGWVESRFGLQPTFHKEPLGRYPSEAWMTYLEEKMSARFHNNGIHAQLDLLYE 164 Azoarcus sp. KH32C
Q21AY8        92 pRRYRSSFLRLITGWGCDSNGAEGAVLKGWVESRFGIFPTFHKAFIDRISSGTWTTYVEEKMSSRFHNNAIYVQLDLLFE 171 Rhodopseudomona...
Q6N757       105 rRRFRSSYLDLIKGWGFDSNGAEGAVLKGWVESRFGLFPTFHKEPIRRIASPVWTVYVEQKMSSRFHNNAIFVQLDLLYE 184 Rhodopseudomona...
WP_013068716  90 -KRFRSSFLRLIQGWGFDSNGPEGAVLKGWVESRFGILPSFHKEIIPDTQGPVWQAYVAERMQSRFHDNAILVQLDLLFE 168 Rhodobacter cap...
Q2RUK5       198 YCQWVLTTFLs--PE--ERHLTLYRGVNAFEEHQILARIDP-----RTVVLRLNNLTSFSSDREVADCFGDIILTVRVPK 268 Rhodospirillum ...
Q607D2       177 FCQWAIARFEt--PA--RRHVRLYRGVDSLGEFCPLGAGNG-----REILVRLNNIVSFSADRTQAGQFGAYILETEVPV 247 Methylococcus c...
WP_013820346 165 YCQWVIERFHf--PA--ARHKTLYRGVNNLDDYSVAADADK-----NQKIVRFNSLVSFTDMRNIASEFGSYILEVQVPV 235 Methylomonas me...
Q6N9V5       170 YCQWSIRRFKt--PG--PRFVRLWRGTNDVEQQLVEGDARQ-----RLCTVRLNNLVSFSDSKERAEEFGDWVLETEVPT 240 Rhodopseudomona...
WP_014430471 170 YCQWMLARFElmgAG--PH-VTLWRGSSNVEEQIVAGSLRE-----RRCTVRLNNIVSFTRSREQAGCFGDWVFEARVPL 241 Rubrivivax gela...
EHR69905     166 FSQWMLRRFPallPQreGPHVRLWRGSTQVEEQLVAGSLRQ-----RHCTVRLNSVVSFAVTREAAECFGDWIFEALVPL 240 Burkholderiales...
BAL23132     165 YGQRVFRRWLy--PG--RHHLTLYRGVNDFAEHQVVAWLPRekgrlREAIARQNNLVSFTTQRDVADQFGDTILEVEVPL 240 Azoarcus sp. KH32C
Q21AY8       172 FCQWALANLVa--PG--KSHVTLYRGVNDFDEHQVVERIDK-----TTVMMRLNNLSSFSSDREIAECFGDTILTVRVPL 242 Rhodopseudomona...
Q6N757       185 FCQWALTHFAa--TG--STHITLYRGVNGFDEHQVVERLDK-----RHCIIRLNNLTSFTSDRGVADCFGDTILTVRVPV 255 Rhodopseudomona...
WP_013068716 169 FCQWAVARFAy--PG--QSHLTLYRGINAVDRHGILEQQSR-----RAAVIRLNNLVSFSSDREVADCFGDRIITTRVPL 239 Rhodobacter cap...
Q2RUK5       269 VKVMFFNALLPFFPLKAEGEFLVIGGDYLART 300 Rhodospirillum rubrum ATCC 11170
Q607D2       248 VKLLFFNDLLPSHPLRGEAEYLVIGGGYRVKI 279 Methylococcus capsulatus
WP_013820346 236 VKLIFFNELLPHHALHGESEYLVIGGDYRVKV 267 Methylomonas methanica
Q6N9V5       241 VKLLFFPGLLQRQVLGYEGEFLVIGGNYKVRA 272 Rhodopseudomonas palustris
WP_014430471 242 CKLLLAPGVLSTRSLQAEGEVLAIGGLYELKV 273 Rubrivivax gelatinosus
EHR69905     241 AKVVVAPGVLDAPLLQGEGEVIALGGDYEVKA 272 Burkholderiales bacterium JOSHI_001
BAL23132     241 CKVVYCNALMPGPVLRGEGEVMVLGGEYRVRM 272 Azoarcus sp. KH32C
Q21AY8       243 SKVVFFNTLLAAYPFKGEREYLVIGGEYRVNA 274 Rhodopseudomonas palustris BisB18
Q6N757       256 AKVLFFNKLLAAHPLKGEGEYLVIGGDYRVTA 287 Rhodopseudomonas palustris
WP_013068716 240 AKVLFFPGLLPSPLLRGEREFLVLGGAFRVSI 271 Rhodobacter capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap