Conserved Protein Domain Family
DUF1481

?
pfam07356: DUF1481 
Protein of unknown function (DUF1481)
This family consists of several hypothetical bacterial proteins of around 230 residues in length. Members of this family are often referred to as YjaH and are found in the Orders Vibrionales and Enterobacteriales. The function of this family is unknown.
Statistics
?
PSSM-Id: 399971
View PSSM: pfam07356
Aligned: 25 rows
Threshold Bit Score: 201.736
Threshold Setting Gi: 81398910
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6LLX3        37 SGGEITGDTTSLYWYSHRQKRaiqlSEVLIGGDASKYQ-------SDYRWREGKLREMKRQGTqlhddG-LKSFTMHVRY 108 Photobacterium ...
WP_014204005  33 TGGQSMGDATSFYWYTERQNQpssaADYVSSERFGWYT-------SSYRWDEGQVREVVREGVqpknkV-LVPYRVQLRF 104 Vibrio furnissii
Q9KV82        48 TGGKTIGDATSFYWYTESFQKpssaSDYVTSGDYGSYQ-------TSYRWEEGQVREIRREGEhldgkK-LVPFRVHIRF 119 Vibrio cholerae
CAV20249      34 TGGQVMGDATSFYWVTNKLTQphtsADYVTVGDYGWYQ-------TDYAWSEGILREFIREGEqrnssNeLVPYSVHVRF 106 Vibrio tasmanie...
Q87KS7        45 SGGKTVGDTSSLYWMTERLTRvstaADYVTMGDHGWYK-------SDYRWDEGELRELIRKGEqidakQrLVPFQIHIRF 117 Vibrio parahaem...
Q7MGT3        36 SGGQTMGDATSFYWVTDKLTGphkaSDYVFSGDYGWYQ-------SEYRWDEGALRELIREGEqldskLgLVPYRIHVRF 108 Vibrio vulnific...
CBJ88696      39 ASGFVADNGIIRLWRLNDQNS----KPQVIMSVYSPYHnkn-ttvTFYEYRHGNLWQIRRNVLghslnD-KMPIAETLRI 112 Xenorhabdus nem...
WP_004246923  40 ATGYIADEGVVRLWRLNNKTS----EPQVIMSVYSFYQkpe-tvvTFYEYRQNRLWQIRSEIVn----P-SHPSSWHLRL 109 Proteus
CCH:MU9_714   30 ASGYIADDGAVRMWRLNADN-----QPRVLMSVFSPYRsgqqtvvTVYEYRRGQLWQIRAEYL-----G-DNGFSEQIRL 98  Morganella morg...
ACR67430      35 ATGYIADGGIVRLWRLEGAGH----QPQAMMRVFTPLDgte-tqiDRYTYRAGYLYQILQQTG-----Q-GNDDVLQLRF 103 Edwardsiella ic...
Q6LLX3       109 DTEGNAVFQRYTVADTVLPLSDAQLTELKIQANTAIELVKNQNKQGKSLIQGRWAGNRFMRCGDNReFEVAFQPTLSDSM 188 Photobacterium ...
WP_014204005 105 NKDGEAVYQQYRVDGKVLPLNQDQLSHYQQQANALAEMTKSQDAQGLELIQGVWDGEVFETCTGREyRRIEFNQTLPNFV 184 Vibrio furnissii
Q9KV82       120 SKEGEAVYQQYRLGGKVLPMNEEQLAHYVLQAKAVAEATKEQDKQGLELIQGYWNGKTFETCQGVEyQRVEFNQSLPSFV 199 Vibrio cholerae
CAV20249     107 NKSGEAVYQQYRIDSKILPIQVKQLESYQKEAKSVLETTMKQHDEGLRLVQGYWNGKTFQTCSGKQfSDIEFNQTLPNFV 186 Vibrio tasmanie...
Q87KS7       118 NKDGEAIYQQYRVNRKVLPLQREQLDRYKAEANDVVVAIKEQSRNGQNLVQGYWNGQAFETCKGKEfSTLEFNQTLPKFV 197 Vibrio parahaem...
Q7MGT3       109 NVEGDAVYQQYRLNGKVLPIQKEQLQRYQYEADALVKETKQQAREGLELVQGYWDGETFETCSGEEySTLEFNQTLPGFV 188 Vibrio vulnific...
CBJ88696     113 DQNNVVIFKLRQLKDRNELLSDNDVKSLQLDAKQILETSDALIAKNIMLLQGHWQNSRVTTCAGKQ-LFIEFNPDAQRWL 191 Xenorhabdus nem...
WP_004246923 110 NKRGEVIFMQQEYQGQKRPLTEDERLKMVFAASREREISKALAIGQVKLVQGTWYQDTLTTCAGEK-VNVSFEAPEQRWL 188 Proteus
CCH:MU9_714   99 DHEGNTIFMQRDKDGHKSPLTADEITRMTFVADRQLTLNSALVIGDIRLKQGQWRDSYVTDCQGNK-SYIEFDAETEQFL 177 Morganella morg...
ACR67430     104 DMQGALSYMQRLRNGSKEMPGSDEVAKAQYQARHAQEMAATLVAGGVNLIQGRWQGGIFTRCDGQV-SPLPLSGWQAAQL 182 Edwardsiella ic...
Q6LLX3       189 LKQVqaQSQDGFMAVNGKIQKkaliaEQLLLLKDNTQhCIYPPK 232 Photobacterium profundum
WP_014204005 185 VNRL--SSLDSYVAFLGKIRNdkvyvEELLMLADDNHdCIRRPN 226 Vibrio furnissii
Q9KV82       200 FNRL--ASIESYVAFLGKIRNgkvhiDELLLLDDAGHdCVKEPE 241 Vibrio cholerae
CAV20249     187 INRL--SSVESYGAFVGKESLrklsvAEFLMLADDNHqCVTRPS 228 Vibrio tasmaniensis LGP32
Q87KS7       198 VDRL--SSVDSYIAFVGKESRnevvvDSLLMLNDDDFdCVSRPK 239 Vibrio parahaemolyticus
Q7MGT3       189 VNRL--ASVDSYVAFLGKKSSrrlevETLLLLDEDDRdCVEKPv 230 Vibrio vulnificus YJ016
CBJ88696     192 KERQsnSSGPLTIAWLDSSEG-----KQLLLVANDDF-CRWEPT 229 Xenorhabdus nematophila ATCC 19061
WP_004246923 189 KRRTqhLTRPAYVAWLDSPEG-----NQLLMVAEHDF-CKWEPT 226 Proteus
CCH:MU9_714  178 AKRQrsSASPIYIAWLDSPEG-----REILLAANDNF-CKWEPT 215 Morganella morganii subsp. morganii KT
ACR67430     183 ARREanSRGPLWVAWLSAPEG-----AQLLQVANHNI-CAWAPT 220 Edwardsiella ictaluri 93-146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap