Conserved Protein Domain Family
DUF1480

?
pfam07351: DUF1480 
Protein of unknown function (DUF1480)
This family consists of several hypothetical Enterobacterial proteins of around 80 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369328
View PSSM: pfam07351
Aligned: 7 rows
Threshold Bit Score: 136.406
Threshold Setting Gi: 194682376
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2NTD7               1 MTKTTVQIGSFTVDDATLSSGdDQRvKNIVSIPCKSDPDLCLQLDGWDEQTGIPAFLDGKEHILFRQHYDHDNDAWIMRL 80  Sodalis g...
goetting:EBL_c17390  1 MTKTHLRIGTFEIDDAVLKGE-HSG-ERTLSIPCKSDPDLCMQLDAWDDETSIPAVLNGERSVLYRQRYDRHTDAWVMRL 78  Shimwelli...
WP_002911393         1 MSKTNVRIGAFEIDDAELHGE-HQG-ERTLSIPCKSDPDLCMQLDAWDADTSVPAILNGEHSVLYRKHYDRQSDAWVMRL 78  Enterobac...
WP_015697856         1 MGKSSIRIGSYEIDDAHLSTPeAKG-GDKVHIPCKSDPDLCMQLDAWDDHTSVPAVVDGRHSVLYKEKYDAQKDEWIMRL 79  Rahnella ...
CAR42212             1 MNKTTLKIACYEIEDVTLKHSsDNQ-LTYVHIPCDYDKEFCMQLDGWDENTSIPAQLKDKNILLYRHAYDKENHHWILKV 79  Proteus m...
Q7N3N0               1 MNQTKLRISSYEIDDAILSSPsQED-DITISIPCNSDQELCMQLDGWDEHTSIPALLNDKHILLYRKHYDRQKHAWVMRV 79  Photorhab...
WP_002210859         1 MGKSIVKIRQFEVDDAELSSQ-TKG-EHTLSIPCKSDPDLCMQLDGWDENTSIPAILDGKDTLLYKQHYDQHQDAWVMKV 78  Yersinia ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap