Conserved Protein Domain Family
DUF1474

?
pfam07342: DUF1474 
Protein of unknown function (DUF1474)
This family consists of several bacterial proteins of around 100 residues in length. Members of this family seem to be found exclusively in Staphylococcus aureus. The function of this family is unknown.
Statistics
?
PSSM-Id: 369323
View PSSM: pfam07342
Aligned: 2 rows
Threshold Bit Score: 155.971
Threshold Setting Gi: 764427510
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_044360457  1 MNIEIRWLMEEIEIIKEKLEDVISTHSWFIDDVFTTD--RLKSMEEVQRYGYAYNEHRIHCEQLFDLLYMYTGRLDKKIN 78  Staphylococcus
WP_009385228  1 MNWETKSLIEDVDIIKEKINDAVTTFGWFDDEYFTHDsgHHLTKDEILKHGCKYHEHRRYITQHINLLNMYLKELDTVLD 80  Staphylococcus m...
WP_044360457 79 efkDIEKASSSA-DQSKDNA 97  Staphylococcus
WP_009385228 81 ---DIEKASSAKfGDGTDNA 97  Staphylococcus massiliensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap