Conserved Protein Domain Family
Neuroparsin

?
pfam07327: Neuroparsin 
Neuroparsin
This family consists of several locust specific neuroparsin proteins. Neuroparsins are produced by the A1 type of protocerebral median neurosecretory cells of the PI-CC system and display pleiotropic activities: inhibition of the effect of juvenile hormone, stimulation of fluid reabsorption of isolated recta, induction of an increase in hemolymph lipid and trehalose levels, and neurotrophic effects.
Statistics
?
PSSM-Id: 115951
View PSSM: pfam07327
Aligned: 4 rows
Threshold Bit Score: 142.373
Threshold Setting Gi: 6093528
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P10776   1 MKATAALVAATLLLAVTLFHRAERNPISRSCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGpyelHGKCGVGMD 80  migratory locust
Q966Y0   1 MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCVVDLTRCEYGEVTDFFGRKVCAKGPSEHCND----FIKCGDGLR 76  Schistocerca gregaria
Q95PM4   1 MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCVVDLTRCEYGEVTDFFGRKVCAKGPGERCSD----YESCGDGLR 76  Schistocerca gregaria
Q95PM5   1 MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCVVDLTRCEYGEVTDFFGRKVCAKGPGDDCNV----YASCGIGMD 76  Schistocerca gregaria
P10776  81 CRCGLCSGCSLHNLQCFfFEGGLPSSC 107 migratory locust
Q966Y0  77 CNCGRCTGCSMHTLQCY-SDFSTPTTC 102 Schistocerca gregaria
Q95PM4  77 CAQKLCVGCSLATLQCFsIVSLPLSEE 103 Schistocerca gregaria
Q95PM5  77 CRNKKCSGCSVKTLECY-FESFPMSEE 102 Schistocerca gregaria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap