Conserved Protein Domain Family
DUF1466

?
pfam07326: DUF1466 
Protein of unknown function (DUF1466)
This family consists of several hypothetical mammalian proteins of around 240 residues in length.
Statistics
?
PSSM-Id: 399956
View PSSM: pfam07326
Aligned: 15 rows
Threshold Bit Score: 292.091
Threshold Setting Gi: 525018141
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_415930      1 MASMLQNVKATMGWQRRLLLADFDENESPVPDKFKRKASFSSLHTICMSLRKRIPLKQVELNFHETPLWENMEARNKSQV 80  chicken
XP_006100736   1 MASRWPGVSTSMRRRSLQDHQQLEESDELPPAAGHLEASGGALGSLCRQFQRRLPLRAVSLNLGAGPSWKRLETPEPEQQ 80  little brown bat
XP_013968962   1 MASKWPGVGASGR----QDQEQLQEPEVVLRAAGHPDISCGALGSLCRQFQRRLPLRAVSLNLGAGPSWKRLESPEPGQQ 76  dog
XP_011234364   1 MASKWPGVGASVRRTSLQDQEQLED-EVLQPAAGHPETSCGALGSLCRQFQRRLPLRAVSLNLGARPSWKRLESPESGQQ 79  giant panda
XP_023099528   1 MASKWPGVGVSLRRGPLQEREQLAEKEAEQTAGGHPEPSSGALGSLCRHFQRRLPLRAVSRNLGAGPSWKRLENPEPSQQ 80  domestic cat
XP_003416906   1 MASRWQGVGASRRRRSLQDQEQLQENVVPQPAVGHLESSTSALGSLCRHFQRRLPLRAVNLNLGAGPSWKRLENPEPGQQ 80  African savanna...
XP_003799078   1 MASRWQGMRSSVRRRSLRNQEQLEDSKALQSVVSHQETST--LGSLCRQFQRRLPLRAVSLNLGAGPSWKRLETPESGQQ 78  small-eared galago
1_pfamImport   1 MVSQWQNARASMHHRSLQHQGQLLDSKERQPMVSHREISARALGSLCRQFQWRLPLRVVNLNL-------RTKTPRNQGQ 73 
Q9BSJ6         1 MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQ 80  human
XP_005056615   1 MASVLQNVKATVTWRKHQLLADLNENESPVPDKFKRRASQSSLSTICMSLRKRAPLKRVELNFHKTPTRESLEPRQRGQT 80  Collared flycat...
XP_415930     81 ----FQSITKTARNAFGTVSQKIQKTCQSPVHSTVTFPAEDIGSSSATCFSKkrr-tvQTPclsvnsvtPAARSKCTLRS 155 chicken
XP_006100736  81 g---LQAAARSAKNALGAVSQRIQESCQSGTKWLVETQVKARRRKRETQKGG------SPP--------ARSLSQRSTRL 143 little brown bat
XP_013968962  77 g---LQAAARSAKNALGAVSQRIQESCQSGTRWLVETQVKARR-RRGPQKGS------SPP--------AHSLSQKGGRL 138 dog
XP_011234364  80 g---LQAAARSAKNALGAVSQRIQESCHSGTKWLAETQVKARRRRRGAQKGG------SPP--------PRSLSQESARL 142 giant panda
XP_023099528  81 g---LQAAARSAKNALGSVSQRIQESCQSGTKWLVGTQVKARKRRRGAQTGS------RPP--------AHTPGQKSPRL 143 domestic cat
XP_003416906  81 g---LQAAARSAKNALGAMSQRIQESCQNGTKWLVETQVKARRRKRGAQKGG------SPP--------PRSLSQKNTRL 143 African savanna...
XP_003799078  79 d---VQGAARSAKSALGAMSQRIQESCQSGTKWLVETHVKARKGKRGAQKDN------SLP--------AHSLTQKSTRL 141 small-eared galago
1_pfamImport  74 gskrLQAAARSAKSTLGAMSQRIQESCQSSTKCLVETQVKARRRKKGVQKGS------VSP--------THSLSQKRIQL 139
Q9BSJ6        81 g---LQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGS------GSP--------THSLSQKSTRL 143 human
XP_005056615  81 ----LHAIKRRAKYAFGTMSQKIQKSCQSPVCSVVTLPAEPISSSCVISSTKkrsttpRTPcck--svtPAASSKGTPRS 154 Collared flycat...
XP_415930    156 SRRSLLGPTTASEHKELRGFPSWHGEDAVPLLKSRTAsAALKSLYSSPTPTCRRIeEFDCELELVSSGIHQLKHLFWAPD 235 chicken
XP_006100736 144 SGTGPACSTLGPWGWERHRRSTQMGPRAHPLRRSRRE-AAFRSPYSSTEPLCSPS-ESDSDLEPVGAGIQHLQKLSQELD 221 little brown bat
XP_013968962 139 PGTVPAYLSLGPWE-DCHRPSAHGGPRAYPGRRFRRD-AALRSPYSSTEPLCSPS-ESDSDLEPVGAGLQHLRKLSQELD 215 dog
XP_011234364 143 SAAAPAYAALDPGERDGRRLSAHAGPRAHPLRRSRRE-AALRSPYSATEPLCSPS-ESDGDPEPVGARLQHLQRPSQELD 220 giant panda
XP_023099528 144 CGAAPASSALGPRERPCRRLSGHVGPRAHPQWRSRRE-PTFRSPYSSTEPLCSPS-ESDSDPEPVGAGLQHLQKLSRQLD 221 domestic cat
XP_003416906 144 SGATPAYSALDSWKKEQHSLSAQRSPQTHPLRRSRRE-AAFRSPYSSTEPLCSPS-ESDSDLEPVGMGIQRLQKLSHKLD 221 African savanna...
XP_003799078 142 SRATPVHSTTDSWERGHHYRSIQMGLRTPQLRRSRRE-AAFQSPYSSTEPLCSPS-EPDGDLEPVGAGIQHLQKLSQELD 219 small-eared galago
1_pfamImport 140 SGAAPDHSATDP----HHHLSTCTGSRA-SLWQWRRE-TAFQSPYSSIELLCSPS-KSDSDLEP-GAGIRHLQKLSQELD 211
Q9BSJ6       144 SGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRRE-AAFRSPYSSTEPLCSPS-ESDSDLEPVGAGIQHLQKLSQELD 221 human
XP_005056615 155 SRRALLGPTRVSEHREWREFSSWLDKNAVSLRRSRRA-AALKSPYSSPAPSSRRI-EFDCELDLVSSGICQLKCISQAFD 232 Collared flycat...
XP_415930    236 DAIVHGDR 243 chicken
XP_006100736 222 EAIAAEES 229 little brown bat
XP_013968962 216 EAIVAAEG 223 dog
XP_011234364 221 DAIVVEES 228 giant panda
XP_023099528 222 EAIVAEES 229 domestic cat
XP_003416906 222 EAIVAEDS 229 African savanna elephant
XP_003799078 220 KAIMAEDS 227 small-eared galago
1_pfamImport 212 EAIMVKER 219
Q9BSJ6       222 EAIMAEER 229 human
XP_005056615 233 DAIVKEER 240 Collared flycatcher
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap