Conserved Protein Domain Family
DGCR6

?
pfam07324: DGCR6 
DiGeorge syndrome critical region 6 (DGCR6) protein
This family contains DiGeorge syndrome critical region 6 (DGCR6) proteins (approximately 200 residues long) of a number of vertebrates. DGCR6 is a candidate for involvement in the DiGeorge syndrome pathology by playing a role in neural crest cell migration into the third and fourth pharyngeal pouches, the structures from which derive the organs affected in DiGeorge syndrome. Also found in this family is the Drosophila melanogaster gonadal protein gdl.
Statistics
?
PSSM-Id: 369318
View PSSM: pfam07324
Aligned: 10 rows
Threshold Bit Score: 244.692
Threshold Setting Gi: 762156754
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q17NK5              270 DS--QAESQEsttdlalveepyqsqefLQRKLYFLLEQLKKMHA-TLPEQFQLRISYELLAGLANSLLNDTIFEIVKGLM 346 yellow f...
XP_011416515         36 EE--IVRREN-----------------QQKRHYFYQNELQNMAR-ELPGKYQQRLPYDLLSSLANSLLDGTVFEIVRSLQ 95  Pacific ...
WGS:AAQB:GK15388-PA  15 ET--AADSESq---------------cLQRKIYFLVDNLRSYHA-ELPVTLQTRISYELLTELAHCVLNEGIFEIVKALL 76  Drosophi...
XP_002932120          9 EE--PRDITQ-----------------QQERHYYLLSELQSLVK-DLPSSCQQRMSHTILSDLALALIDGTVFEIVQGLL 68  tropical...
O73770                9 YEvaAAELSR-----------------QQERHYRLLSELQELVK-ALPSSCQQRLSYTTLSDLALALLDGTVFEIVQGLL 70  chicken
1_pfamImport          8 EE--AADGAR-----------------QQERHYQLPSALQRAAQvHDRGSCQRRLSYTTLSDLALALLDGSVFEIVQGLL 68 
O35347                9 DE--AADRAR-----------------QQERHYQLLSALQSLVK-ELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLL 68  house mouse
CAF93131              5 pgavSGDSTK-----------------QQERHYYLLSELQALVK-DLPSSFQQRLSYSTLGDLALALIDGTVYEIVQGLL 66  spotted ...
XP_014340653         12 EE--PADTTK-----------------QQERHYYLLSELQNLIK-SLPSSCQQRLSYTMLSDLALALIDGTVFEIVQGLL 71  coelacanth
XP_001353153          9 EG--PTNGSEpvavaedp-fqqpspefLQRKIYFLVDQLRTMHA-ELPENLQTRISYDLLTELANCVLNDSIFVIVKALM 84  Drosophi...
Q17NK5              347 EIQHVTEKHLMQVREKVENDHQLEV----------KQWESKIQDPEE----LEHIIALMKIKHSKNM-----------KE 401 yellow f...
XP_011416515         96 EVQQLEERHLHTQRVKLVNDHKAQR----------HELQKRHKELLQgcqtKPHNLPIVEVQIEREKetmekrceeevKK 165 Pacific ...
WGS:AAQB:GK15388-PA  77 ELQHATEKHLLQMRLQVENEYEIEV----------TEWCSKIKDPKE----LAHLLDLLKAKHVNKL-----------KD 131 Drosophi...
XP_002932120         69 EIQHLTEKNLYNQRLKLHAEHRGLK----------QDLLRKHREAQQs--cKAHNFQVLKATQQRELesleqrikeeqRM 136 tropical...
O73770               71 EIQHLTEKNLYSQRLKLHSEHRGLK----------QELFHRHKEAQQc--cRPHNLPLLRAAQQREMeaveqrireeqRM 138 chicken
1_pfamImport         69 ETQHLTEKRLYSQRLRLQDGHRVLR----------QALRQKHEEAQEa--cQPHNLPLLQEAALRCTrsgrqwiheeqQT 136
O35347               69 EIQHLTEKSLYNQRLRLQNEHRVLR----------QTLRQKHLEAQQs--cRPHNLPVLQAAQQRELeamehrireeqQA 136 house mouse
CAF93131             67 DIQHLTEKNLYNQRQKLHCEHQALK----------QELTKKHKDALQt--cKSHNLALLKTNQQAEVealeirvreeqRM 134 spotted ...
XP_014340653         72 EIQHLTEKNLYNQRLKLHSEHRGLKldllrkqkeaQQSC------------KSHNLSLLKTAQQRELealeqrikdeqRM 139 coelacanth
XP_001353153         85 ELQHETERHLIKMRMQVENEYEIEV----------SDWRAKIKDPEE----LLHILGLMKLKHSKKL-----------VE 139 Drosophi...
Q17NK5              402 TDMKLVLHLDQKVKDQQSTLEKAGVPGFYVSDNPMEIKIQMYLLDFILRLSR 453 yellow fever mosquito
XP_011416515        166 KDMKIIMELDQKVMDQQVMLEKAGVPGFYVTNKSIDVRIQMYLLDFITRLGH 217 Pacific oyster
WGS:AAQB:GK15388-PA 132 ADKKIIEVLDQKVNDQQSTLHMAGVPGFYATQNAKEIKIQMFLLDFILRLSR 183 Drosophila willistoni
XP_002932120        137 MDEKIVLELDQKVIDQQTTLEKAGVSGFYITKNPQELMLQMNILELIQKLQQ 188 tropical clawed frog
O73770              139 MDEKIVLELDQKVIDQQSTLEKAGVSGFYITTNPQELTLQMNLLELIRKLQQ 190 chicken
1_pfamImport        137 MDKKIILELDQMVADQQSTLEKAGVTGFYITTNLQELTLQMNLLKLIRKLQQ 188
O35347              137 MDRKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELTLQMNLLELIRKLQQ 188 house mouse
CAF93131            135 MDKKIVAEMDQKVVDQQNTLEKAGVPGFYITTNPQELTMQMNLLELILKLQQ 186 spotted green pufferfish
XP_014340653        140 MDEKIVLELDQKVIDQQSTLEKAGVPGFYVTTNFQELTLQMNLLELILKLQQ 191 coelacanth
XP_001353153        140 SDKKIIEILDQKVNDQQSTLQKAGVPGFYVTENPKEIKIQMFLLDFILRLSR 191 Drosophila pseudoobscura pseudoobscura
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap