4MH6


Conserved Protein Domain Family
YscO

?
pfam07321: YscO 
Click on image for an interactive view with Cn3D
Type III secretion protein YscO
This family contains the bacterial type III secretion protein YscO, which is approximately 150 residues long. YscO has been shown to be required for high-level expression and secretion of the anti-host proteins V antigen and Yops in Yersinia pestis.
Statistics
?
PSSM-Id: 399954
View PSSM: pfam07321
Aligned: 12 rows
Threshold Bit Score: 76.6691
Threshold Setting Gi: 503715001
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MH6_A          26 IERLLEIKKIRADRADKAVQRQEYRVANVAAELQKAERSVADYHVWRQEEEERRFAKAKQQTVLLKELETLR----QEIA 101  Vibrio parah...
Q2SH49           2 IASIAEIKQHRTNRQARQVKSLEIALSDLRERRSQSAHAFTDFQQWRRRESDRLFAELAGKPASLQEVDDYN----SRVT 77   Hahella chej...
Q2SC35           2 LSALADIKKLRERNAQAEALRKRQLLTQSREKVEEAQRDLQQFEIWRVQEEHRLYDSIMGSEVGLKAIDKVK----HQIG 77   Hahella chej...
jgi:DvMF_2436    7 LQPLLNVRHFRENGARNALMTAEGVLRDAMQAAEDRRAELERYRAWRPGEEERRYDAIMGTSMAVEDLDRFK----AGLA 82   Desulfovibri...
WP_011526622     6 LAPLLSVREHKEELAQQAVLRAENALVEARKDLQKAEEDCKNYEEWCQQEINRYYSEIIGSLVLFKELELLK----VKTG 81   Lawsonia int...
CAE42519         3 LESLLAIKHFRADQAQLALKRQQQACAVAAAAQRQAQGRLDDCRLWAGQLENRLYAELCRRIVKTRDIDEVL----QRVG 78   Bordetella p...
CDM23303         4 FRELIAIKRFREGQAELAMMRQRQVLAEAERLRLQAVEHLDEYRRWSEQRELDMYRDLCSRLVRASEIEDVL----ENVA 79   Castellaniel...
Q4CP84        1222 PRNFLKVESAEKREEEKVQKR---------PAHRSTSSSSAPIRALLADADANIIVKPQIAAMLQREIEKAQrnnmHEIS 1292 Trypanosoma ...
Q9I331           3 LALLLRVRRLRLDRAERAQGRQLLRVRAAAQEHTERQAAQRDYRDWRLAEEQRLFLACQAAMLDRRRLEAWQ----QQVG 78   Pseudomonas ...
WP_013949077     6 IRQVQRVKVLQADRAEQEERARRAGLEAAAAAVETARANLERWREEMPRREAAIYDAIIGKLVDLEALDACK----ARVV 81   Hyphomicrobi...
Q7N0W1           2 ISRLQRIKALRVERAEKHFSLQQMKLQTARQHHQQALQTLQDYCQWRIEEEQRLFALCQGQPIDRKGLERWQ----QQVA 77   Photorhabdus...
O30878           2 IRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYHLWRIDEEQRLFDQRKNTTLNCKDLEKWQ----RQIA 77   Yersinia pestis
4MH6_A         102 LLREREAELKQRVAEVKVTLEQERTLLKQKQQEALQAHKTKEKFVQLQQQEIAEQSRQQQYQEELEQEEFRT 173  Vibrio parahaemolyti...
Q2SH49          78 YFKVQSNDLASQLKQIQAQETAAEQKLQAALDQLKAAQRAQEKFAILAEDFQGALQQNRIRLEEQQAEEMAA 149  Hahella chejuensis K...
Q2SC35          78 MLRLKEVSLAEQVEKARQEQKQAEAALRQAEQALAEAGKAVEKCQMLIEQVSADAIAEAQRLEELELEEASE 149  Hahella chejuensis K...
jgi:DvMF_2436   83 ALAQAELQREQAVADADRRVEECRKAVADARAAVAKARREVAKIAAHKDIWSEEMRRETERLADIEMEEFKA 154  Desulfovibrio vulgar...
WP_011526622    82 ILLDNVKEKYKLVDKAKDYVEACIEAKERAIKNLTELKKQTAKLAEHKKLWEAEEKILAQQREEVELEDFKM 153  Lawsonia intracellul...
CAE42519        79 HARDRQASLALQLDDAVRRHEHEIQLLAQQREQHRECFQAQQRIAELVRLQQVEAAALRESQEDREIQEAIE 150  Bordetella pertussis...
CDM23303        80 GLREGEQDRETRVEEAENQAHREAETLTQCREAHREASRMVEKFVQLASLHAAEELRELERKEDLEMEEAAS 151  Castellaniella defra...
Q4CP84        1293 SLRANVRRLESDLEEARQQLRGERDNSRSLRVMVQNARRELEE--KELALVRTSASRQQRAKEHQHVQANFV 1362 Trypanosoma cruzi
Q9I331          79 LLREKEAGLEQDCAEAAQRLEGERERLRQCRRELLERQRQLEKFAELERHVDAERQGLRERSEEGELEEFTR 150  Pseudomonas aeruginosa
WP_013949077    82 ELREHEALLAKRLQDAEGAATAAREALEFASQKLAHARRAVSKFDELVATLRAAELLDAEAKEDAELEEAAE 153  Hyphomicrobium sp. MC1
Q7N0W1          78 LLRENEAQLEKQVAEMTEKVELELRQLKECQRVLHHTRQQQEKFNELGRQQQEAIRAQGEYQEELEQEEFHR 149  Photorhabdus laumond...
O30878          78 SLREKEANYELECAKLLERLANERERLTLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQ 149  Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap