Conserved Protein Domain Family
HEPPP_synt_1

?
pfam07307: HEPPP_synt_1 
Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1
This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (EC:2.5.1.30) (approximately 230 residues long). The enzyme consists of two subunits, both of which are required for catalysis of heptaprenyl diphosphate synthesis.
Statistics
?
PSSM-Id: 399944
View PSSM: pfam07307
Aligned: 14 rows
Threshold Bit Score: 212.931
Threshold Setting Gi: 288547245
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y5X2                  23 YQYLQENNEGGQMDKDQMLFLHEAISG-SDLTDAAAYRVVSATLYMILAHDTHEKIDEpg-dvVKLTRKEQELTVLAGDF 100 Liste...
WP_014098157            22 HDYLNQFIDAPYIDEDRILLLISSLAG-QPYTEHEVKQFVATAMLIQIALDTHEKVTN-----ANENQKNRQLTVLAGDY 95  Bacil...
PRJNA212797:N288_17050  21 HPYLLKYIDEPVIDQDKLLLLVSMLNE-AELTQKQKNDYSVTAMLIQVALDTHEQVSNtq--iAGEMQKNRQLTVLAGIY 97  Bacil...
WP_014643521            24 HPFLARFIPEPAVDEDKLVILSSIMDH-TSLSSVKKEQYIITTMLVQIALDTHDLVTLtedddDQETIRNRQLTVLAGDY 102 Halob...
Q8CXF7                  21 YGYIHKHIQQPLIDEAKWGLLQFLVEQdRSLTPMQRERYIITTMLVQIALDTHDLVPIkkvaeTEQETLSKQLQVLSGDY 100 Ocean...
Q5WGT5                  25 YDYLQGYIDNTRPDADELWLVYTILTE--SEPPDRAGAITLAWGFAHAGLLIHDLVSLhn-tnEEFAKKKRQLNVLAGDF 101 Bacil...
Q9KCC5                  21 HAYLEKYITKPIVDEDKLRFLYTMLAE--KLPKKDTKLFTLSALLVDAALEIHEAVSLhn-iqTDPIKKNRQLNVLAGDY 97  Bacil...
Q65I23                  21 HPYLAKHLTAPKVDEDKLFLFYALFEE-TDLKEADKESYILTAMLVQTALDTHDEVTTaa-siKQDDYKNRQLTVLAGDY 98  Bacil...
WP_012010388            21 HPYLAKHLRAPLIDEDKLLLFHAMFDE-AQIDAEKKENYILTAMLVQIALDTHDEVTTaa-aiKQDEFKNRQLTILAGDY 98  Bacil...
Q81SW1                   6 HPYFINYIEEPFIDEEKIALLYGALKG-ANLHIEQIEHYVVTIMLVQIALDTHERVSNksgeeANESHKHRQLTVLAGDY 84  Bacil...
Q8Y5X2                 101 YSALYYRTLAELEMIPLLRALQSGVQETNTAKTNIYQLHVATDEEYLSQLTLTNAAIFAKFAKYFmKDETFIALGCQFFL 180 Liste...
WP_014098157            96 FSSLYYKLLAGVHNVRLVGILAEGIKSVNEYKVMLYQFDDSDAETFVGHLKKTESAIITKFMQFF-GSQPLIRLSEELLL 174 Bacil...
PRJNA212797:N288_17050  98 YSSLYYKILSESKDIGMIRLLSDGIKEVNEHKISVYQHETENVEGLMESVRLIESSLFSKIAECF-NKPAWTELSSHLLL 176 Bacil...
WP_014643521           103 YSGLYYYLLSQLEDIPMIQTLAGAIKEINELKMELYYKDVESFQEFLNGLKKIESLLIQRVASYV-QRTTINDIAGEWLL 181 Halob...
Q8CXF7                 101 YSGLYYFLLSEVGEIEFIQTLANAIREINELKMALYYKDSPTFHERINLTKKINSMLIIHVTQFL-YDDTANDLITDWLI 179 Ocean...
Q5WGT5                 102 YSALYYQALARVHAVDMIELFGSTLQEVYEKKIASHLDKDNSFETRLAQTEEIEALLAVAIANEI-GQEGYEPLLRPFFL 180 Bacil...
Q9KCC5                  98 YSSLYYYLLADSRHLPIIQVFSHSIQEINEYKMKLYDGKNIDFDEVKNNVDKVDTFLLQNLAEHF-QLTTWKKAISVFFH 176 Bacil...
Q65I23                  99 FSGMYYSLLSGMKDIYMIRTLAAAIKEINEHKIRLYDHSAKDADSLKKSVSIVEAALFHHLADHF-YLPHWKTAANDFLV 177 Bacil...
WP_012010388            99 FSGLYYSLLSDMKDIYMIRTLATAIKEINEHKIRLYDRSIQDAAHFYKSVATVESALFQRVSEHF-QLTHWNEIASRFLV 177 Bacil...
Q81SW1                  85 YSGLYYYLLSMNRDIVLIRALAEGIKEINEHKIMLYQKAHKTVDDIMESVVMIESALLQKTCDHF-QLAHWKPFITYVLG 163 Bacil...
Q8Y5X2                 181 LKRLQTELATYKEIGASRLKRAFDHGYFAKEAvSnFESWLVAIIRDVKSEVERLK 235 Listeria monocytogenes
WP_014098157           175 FNRLLREKKQAENGKRSILFEALNKMAYPGDG-RpFEQLPHEKKRKLFYICEKYL 228 Bacillus coagulans
PRJNA212797:N288_17050 177 MKRLMEERGRYLDQGTSFLFERLKRLVFPKKE-QeLADLSAEQKRYLLLIANRYI 230 Bacillus infantis NRRL B-14911
WP_014643521           182 AKKLLEEKKSYQEGKFSPLIDVLVKRPGILGN-----------SGQVIVNIEQML 225 Halobacillus halophilus
Q8CXF7                 180 LQQLELEREYNNSVIGETTINAYQKNVSNLAQ----------TLSNQTAFITHYI 224 Oceanobacillus iheyensis
Q5WGT5                 181 YKRLEKEKENAEAGCLSPLIEAWMAENKQGSL---FKVEQQRQLEQLQEAVDKQN 232 Bacillus clausii KSM-K16
Q9KCC5                 177 LKRLVHEREAWINGKATPLMKAIVTELFGSNR-P-VDELKKDDQLQVLELWEEKV 229 Bacillus halodurans
Q65I23                 178 FKRFAAEEKA----SDSRLLETIIQKEFPEGQ-AsCGQLAAAAYKEAKLAINQSL 227 Bacillus licheniformis DSM 13 ...
WP_012010388           178 YKRFMKQAE------DDKHLKLFLNDSHTDAY-TcFDNFENEGYEKARRSIKEHL 225 Bacillus pumilus
Q81SW1                 164 KNRLQKECELHVNKQHSPVFQAVQGIVNDKAD---AETVMNGWMMKLGKKENQFL 215 Bacillus anthracis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap