Conserved Protein Domain Family
DUF1454

?
pfam07305: DUF1454 
Protein of unknown function (DUF1454)
This family consists of several Enterobacterial sequences of around 200 residues in length which are often known as YiiQ proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 399943
View PSSM: pfam07305
Aligned: 10 rows
Threshold Bit Score: 282.33
Threshold Setting Gi: 194684507
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACR70911             29 TLLFLFVLACQTAVYAASPKATGE--APQPAPYLRPGAPTFDLTLVNFRAHYNQAFPSLPLEEYRAISVRDENLPLTRAA 106 Edwardsi...
Q6CZ82                8 SLLVLSSLVLYQTHAGADPTFPPK--TSANAPYLLAGAPTFDQTITQFRSRYNLSNPTLPIGEFRVVDTGTIISMLTRAA 85  Pectobac...
goetting:EBL_c38710   6 pVLALACTALAASQAGAAPDT-----TAPTAVYLLPGSPTFDLSISQFRARFNLNNPTLPLEEFRAIAPGSDAANLTRAA 80  Shimwell...
P32160                8 FFLLCSALTVTTEAHAQTPD------TATTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAA 81  Escheric...
WP_010616531          7 ALLLSVALTFSAWAEDAPAQDRND--HLPAAPYLLAGAPTFDMTTAQFREKYNAANPDLPLQEYRAIDNRDDKSHLTRAA 84  Plautia ...
WP_013200183          6 FLGITLLLTLTAARADDAPVAQDRteHLPAAPYLQAGSPTFDMTIGQFREKYNAIYPTLQIAEYRAIDNRGDKSNLTRAA 85  Erwinia
Q7MYB4                9 IILAASSVGLPLVANADKSTTTE---PTVQATYLLPNAPSFDETIPRFREKYNRCNPTLPLREYRVIISKNIYPPLTRAA 85  Photorha...
CAR46287             12 liiiSIALSLPTLAMAASPSIAHQppTKDDILYLKQDAPVFETTIPEIRAKFNQNNATLFLNEYKIITNNDITIPLVRAA 91  Proteus ...
WP_004236620         10 aaLTAGCTLLPVTPVAAGDAVLIPipCPPETLWLQADAPAFGITIPVMREQFNRNNPSLPLREYKVVASNDITASYLRAA 89  Morganel...
CBJ83398              2 TILIAFGISLPLSALAGEPSVTPD--TRSQLMYLLPDSPTFEETIPVFREKYNKKYPEIPLHEYKVIVSKDISLPFIRAA 79  Xenorhab...
ACR70911            107 TRINAAVYSSVVLEKGTGKIKSLQITYLPsgdgERGKE-KRGArngaetpdRQLAIRYMAALMQSFSPTISPQQSLEKVA 185 Edwardsi...
Q6CZ82               86 SQINDHLYASTALEKGTGKIKTLQITWLP----QPQNE-QETAa------rRKQAIDYMAALARTFAPSLTEEQSVKKVT 154 Pectobac...
goetting:EBL_c38710  81 SKINENLYASTALERGTLKIKSMQITWLP----IQGPE-QKPA--------RAMALNYMAALIRTFSPALSEAQSQQKLS 147 Shimwell...
P32160               82 SKINENLYASTALERGTLKIKSIQMTWLP----IQGPE-QKAA--------KAKAQEYMAAVIRTLTPLMTKTQSQKKLQ 148 Escheric...
WP_010616531         85 SKISETLYASTALEQGTGKIKTLQITWLP----VPGPD-MKAA--------QTRAMDYMTALLRFFVPGLSPEEGHKKLD 151 Plautia ...
WP_013200183         86 SKINENLYASTALEQGTGKIKTLQITWLP----VPGPD-QKEA--------QDKARAYMAAMERFFEPTLNEAQSLKRLD 152 Erwinia
Q7MYB4               86 SKINEKLYSSAVLERGSEKIKSLQLTLLPs---ENTAE-TQQN--------QMLAEQYMTALMRHFNPTLSQEQSKENID 153 Photorha...
CAR46287             92 TRITPYLYSSAVLERGSEKIKSLQLTLIHs---LDTPQiEKEH--------QDTAMRYITALVTQFDPSINATQIQEVLN 160 Proteus ...
WP_004236620         90 TRISPYIYSSAILERDSEKIKSLQLTLLPg---ADSAA-EKTN--------RALMLAYIKALIIQFEPTLNKNNIDAALS 157 Morganel...
CBJ83398             80 SKINEKIYSSAVLERGSEKIKSLQITLLPp---QSEPE-KEHN--------LALIKQYITALISQFEPTLSPEQANKQLE 147 Xenorhab...
ACR70911            186 ELLSRGRSQPYYSQQDGSLRYVVSDSGEKGITFAVEPIKLSLSE 229 Edwardsiella ictaluri 93-146
Q6CZ82              155 ELLGKGKGQRVYQQTEGALRYVVADDGEKGLTFAVEPIKLTLSE 198 Pectobacterium atrosepticum
goetting:EBL_c38710 148 QLLTSGKNKRYFSRNDGAIRYVVADNGEKGLTFAVEPIKLALSE 191 Shimwellia blattae DSM 4481 = NBRC 105725
P32160              149 SLLTAGKNKRYYTETEGALRYVVADNGEKGLTFAVEPIKLALSE 192 Escherichia coli K-12
WP_010616531        152 GLLSAGKGAHYFSRTEGALRFVVADNGDKGLTFAVEPIKLALAS 195 Plautia stali symbiont
WP_013200183        153 DVLSKGKGSRYYTQDEGAVRYIVADNGDKGLTFAIEPIKLALAt 196 Erwinia
Q7MYB4              154 NLLINSKKSPFYSHNIGAIRYIVVNSSEKTLTFAIEPIKLWLFE 197 Photorhabdus laumondii subsp. laumondii
CAR46287            161 LFAVKQDVPAYISHNVGAIRYIIAHEDNQLTTFAIEPIKLSLNS 204 Proteus mirabilis HI4320
WP_004236620        158 RALATDFKTGTYASQFGALRYLLVVDDKNGVTFAIEPIKLSLSN 201 Morganella morganii
CBJ83398            148 RLLQAAQSHRFFSQKIGAIRYVIVNSSENIMTFAIEPIKLSLSD 191 Xenorhabdus bovienii SS-2004
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap